Instruction
stringlengths
135
4.21k
Keywords
listlengths
1
1.73k
Sequence
stringlengths
8
35.2k
Generate a protein sequence for a novel protein that integrates the following function keywords: Phytocyanin domain, Phytocyanin-like, Cupredoxin. The designed protein sequence is
[ { "Beg": 35, "End": 114, "ID": "IPR003245", "Name": "Phytocyanin domain", "Type": "Domain" }, { "Beg": 25, "End": 125, "ID": "IPR003245", "Name": "Phytocyanin domain", "Type": "Domain" }, { "Beg": 22, "End": 126, "ID": "IPR008972", "Name": "Cupredoxin"...
MASSRVVLILSISMVLLSSVAIAATDYIVGDDKGWTVDFDYTQWAQDKVFRVGDNLVFNYDPSRHNVFKVNGTLFQSCTFPPKNEALSTGKDIIQLKTEGRKWYVCGVADHCSARQMKLVITVLAEGAPAPSPPPSSDAHSVVSSLFGVVMAIMVAIAVIFA
Generate a protein sequence for a novel protein that integrates the following function keywords: Leghaemoglobin, iron-binding site, Leghaemoglobin-like, Globin, Globin-like superfamily, Globin/Protoglobin. The designed protein sequence is
[ { "Beg": 39, "End": 157, "ID": "IPR000971", "Name": "Globin", "Type": "Domain" }, { "Beg": 210, "End": 328, "ID": "IPR000971", "Name": "Globin", "Type": "Domain" }, { "Beg": 12, "End": 162, "ID": "IPR000971", "Name": "Globin", "Type": "Domain" },...
MEENKKTVDGSVDFTEEQEALVVKSWNAMKNNSCDLSLKFFTKILEIAPPAKQMFSFLKDSNVPLEQNPKLKPHAMSVFLMTCESAVQLRKAGKVRVRESNLKKLGATHFKTGVQDEHFEVTKQALLETIEEAIPEMWSLAMKNAWAEAHDQLANAIKVEMKEAHDQMDNANLIINMEENTGSCFTEEQEALVVKSWNAIKYNSGDLSLKFFKKILEIAPPAKQLFSFLKDSNVPLEHNPKLKPHAMSVFLMTCESAVQLRKAGKVTVRESNLKKLGATHFKTGVKDEHFEVTKQALLETIKEALPEMWSPAMENAWGEA...
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycosyl hydrolase family 18, active site, Glycoside hydrolase superfamily, Glycoside hydrolase family 18, catalytic domain, Chitinase insertion domain superfamily, Chitinase II/V-like, catalytic domain, Glycosyl Hydrolase ...
[ { "Beg": 48, "End": 362, "ID": "IPR001223", "Name": "Glycoside hydrolase family 18, catalytic domain", "Type": "Domain" }, { "Beg": 34, "End": 379, "ID": "IPR001223", "Name": "Glycoside hydrolase family 18, catalytic domain", "Type": "Domain" }, { "Beg": 139, ...
MANILNLKHLLTLALILLALATKSSTSSSSSITRVKGIYWLENPFFPPTTVDTSLFTHIFYSFLTPNNITYKLEISSSQILSLNTFTKTFKTKSPPAATLFSIGGAGSNSSLLAFIASDPPACAAFINSTIDVARTFGFDGIDLDWEFPKNTKEMNDLGEMLFQWRKAISDEGATTGRPPLLLTAAVYFAVNFSIYGEPRMYPVNSINENLDWVNVMSYELRGPRSNKTGAPSGTFDPKSNVSVVSGLLSWIHSGVVPEKLVMGMPLYGKSWKLRDPNVHGIGAPSVGSGPGVNGLMAYFQVLDFNRQKSAKVEYDVDTA...
Generate a protein sequence for a novel protein that integrates the following function keywords: Peptidase C1A, Cysteine peptidase, histidine active site, Peptidase C1A, papain C-terminal, Cathepsin propeptide inhibitor domain (I29), Cysteine peptidase, cysteine active site, Papain-like cysteine endopeptidase, Cysteine...
[ { "Beg": 151, "End": 162, "ID": "IPR000169", "Name": "Cysteine peptidase, cysteine active site", "Type": "Active_site" }, { "Beg": 133, "End": 348, "ID": "IPR000668", "Name": "Peptidase C1A, papain C-terminal", "Type": "Domain" }, { "Beg": 151, "End": 166, ...
MAQWTLLIVFFCVATAAAGLSFHDSNPIRMVSDMEEQLLQVIGESRHAVSFARFANRYGKRYDTVDEMKRRFKIFSENLQLIKSTNKKRLGYTLGVNHFADWTWEEFRSHRLGAAQNCSATLKGNHRITDVVLPAEKDWRKEGIVSEVKDQGHCGSCWTFSTTGALESAYAQAFGKNISLSEQQLVDCAGAYNNFGCNGGLPSQAFEYIKYNGGLETEEAYPYTGQNGLCKFTSENVAVQVLGSVNITLGAEDELKHAVAFARPVSVAFQVVDDFRLYKKGVYTSTTCGSTPMDVNHAVLAVGYGIEDGVPYWLIKNSWG...
Generate a protein sequence for a novel protein that integrates the following function keywords: CLAVATA3/ESR (CLE)-related protein 1-4. The designed protein sequence is
[ { "Beg": 1, "End": 75, "ID": "IPR039616", "Name": "CLAVATA3/ESR (CLE)-related protein 1-4", "Type": "Family" } ]
MASWRMLCFVLLFTSILICHDARPLPSSLSSSNGSPAFVESVKQVVKEIMRRKQLLGTQYSTNRLSPSGPDPHHH
Generate a protein sequence for a novel protein that integrates the following function keywords: NAD-dependent epimerase/dehydratase, NAD(P)-dependent dehydratase-like, NAD(P)-binding domain superfamily. The designed protein sequence is
[ { "Beg": 20, "End": 252, "ID": "IPR001509", "Name": "NAD-dependent epimerase/dehydratase", "Type": "Domain" }, { "Beg": 14, "End": 323, "ID": "IPR036291", "Name": "NAD(P)-binding domain superfamily", "Type": "Homologous_superfamily" }, { "Beg": 19, "End": 316,...
MPAATAAAAAESSSVSGETICVTGAGGFIASWMVKLLLEKGYTVRGTLRNPDDPKNGHLKKLEGAKERLTLVKVDLLDLNSVKEAVNGCHGVFHTASPVTDNPEEMVEPAVNGAKNVIIAGAEAKVRRVVFTSSIGAVYMDPNRSVDVEVDESCWSDLEFCKKTKNWYCYGKAVAEAAAWDVAKEKGVDLVVVNPVLVLGPLLQPTINASTIHILKYLTGSAKTYANATQAYVHVRDVALAHILVYEKPSASGRYLCAETSLHRGELVEILAKYFPEYPIPTKCSDEKNPRVKPHIFSNKKLKDLGLEFTPVSECLYETV...
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycosyl hydrolase family 18, active site, Glycoside hydrolase superfamily, Glycoside hydrolase family 18, catalytic domain, Chitinase insertion domain superfamily, Chitinase II/V-like, catalytic domain, Glycosyl Hydrolase ...
[ { "Beg": 55, "End": 369, "ID": "IPR001223", "Name": "Glycoside hydrolase family 18, catalytic domain", "Type": "Domain" }, { "Beg": 39, "End": 384, "ID": "IPR001223", "Name": "Glycoside hydrolase family 18, catalytic domain", "Type": "Domain" }, { "Beg": 144, ...
MAVQKIIITPILVFLVTIFFNVSSSSSSNNSQYQFLNHGVRSAYWPAGDDFSPSLIDTNYFTHILLAFIQPEPISFKLEITKSGIKWGQNFIKALRHRSPPVKTLLSIGGGGSNSTLFSEIASTKQNREIFINSTIEVARKYRFDGVDLDWEFPETQQDMFNLGLLYEEWYNALFAEAKVRRKPRLLLTSAVYYNSTVRLIGKHGPRSYPTQAINKYLDWASPMCFDYHGTWDNNTDFNAALYDSKSEISTNFGLHSWIKSGVRPEKLVMGLALYGRAWELKDPNVNGVGAEAVGPATDTDGSMNYNEILKFNKQSGANV...
Generate a protein sequence for a novel protein that integrates the following function keywords: SGNH hydrolase superfamily, GDSL lipase/esterase, GDSL lipase/esterase-like, plant. The designed protein sequence is
[ { "Beg": 40, "End": 365, "ID": "IPR001087", "Name": "GDSL lipase/esterase", "Type": "Family" }, { "Beg": 38, "End": 368, "ID": "IPR035669", "Name": "GDSL lipase/esterase-like, plant", "Type": "Family" }, { "Beg": 30, "End": 370, "ID": "IPR036514", "Nam...
MKFMAKIELSRHIPLVTLIVLVLCITPPIFATKNCDFPAIFSFGASNVDTGGLAAAFRAPPSPYGETYFHRSTGRFSDGRIILDFIARSFRLPYLSPYLNSLGSNFTHGANFASGGSTINIPKSILPNGKLSPFSLQIQYIQFKEFISKTKLIRDQGGVFATLIPKEDYFSKALYIFDIGQNDLTIGFFGNKTIQQVNATVPDIVNNYIENIKNIYNLGARSFWIHGTGPKGCAPVILANFPSAIKDSYGCAKQYNEVSQYFNFKLKEALAELRSNLSSAAITYVDIYTPKYSLFTNPEKYGFELPFVACCGYGGEYNIG...
Generate a protein sequence for a novel protein that integrates the following function keywords: Ammonium transporter, conserved site, Blood group Rhesus C/E/D polypeptide, Ammonium transporter AmtB-like domain, Ammonium/urea transporter, Ammonium transporter. The designed protein sequence is
[ { "Beg": 8, "End": 452, "ID": "IPR001905", "Name": "Ammonium transporter", "Type": "Family" }, { "Beg": 24, "End": 440, "ID": "IPR001905", "Name": "Ammonium transporter", "Type": "Family" }, { "Beg": 121, "End": 137, "ID": "IPR002229", "Name": "Blood g...
MSGVPFPSNLLPSPSSPEWLSKADNAWQLMAATLVGMQSVPGLIILYGGAVKKKWAVNSAFMSLYAFACVFFCWVFWAYRMSFGDTLFPFWGKPALALDEKYLFKQAFLGAFPNATMIYFQCVFAAITLILIAGAVLGRMNFYAWMMFVPLWLTFSYTFTAFSIWSTNGFLAKMGIIDYSGGYVIHLSSGVAGFTAAYWVGPRLNKDRERFPPNNLLLMLAGAGLLWMGWTGFNGGDPYSVGLDASLAVLNTHACTATSLLTWVFLDVIFFRKPSVIGAVQGMITGLVCITPAAGVVQGWAALIMGLFSGSIPWFTMMVI...
Generate a protein sequence for a novel protein that integrates the following function keywords: Ankyrin repeat-containing domain superfamily, Regulatory protein NPR, central domain, Regulatory protein NPR5/6, SKP1/BTB/POZ domain superfamily, BTB/POZ domain, Ankyrin repeat. The designed protein sequence is
[ { "Beg": 18, "End": 109, "ID": "IPR000210", "Name": "BTB/POZ domain", "Type": "Domain" }, { "Beg": 25, "End": 107, "ID": "IPR000210", "Name": "BTB/POZ domain", "Type": "Domain" }, { "Beg": 25, "End": 160, "ID": "IPR000210", "Name": "BTB/POZ domain", ...
MSLEETLRSLSLDYLNLLINGQAFSDVTFQVEGRLVHAHRCILAARSLFFRKFFCGPDPPSGLDPIGGGSSRQPTVRPGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLVSMVEKASIDDVMKVLIASRKQEMPQLWTTCSHLVAKSGLPPEILAKHLSIDVVAKIEELRLKSSLARRSLMPLHHHHHHHHHHDFGDLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGPAGKTSLHVA...
Generate a protein sequence for a novel protein that integrates the following function keywords: Cyclic nucleotide-binding domain superfamily, Potassium channel, voltage-dependent, EAG/ELK/ERG-like, Cyclic nucleotide-binding domain, Ion transport domain, RmlC-like jelly roll fold. The designed protein sequence is
[ { "Beg": 503, "End": 561, "ID": "IPR000595", "Name": "Cyclic nucleotide-binding domain", "Type": "Domain" }, { "Beg": 480, "End": 565, "ID": "IPR000595", "Name": "Cyclic nucleotide-binding domain", "Type": "Domain" }, { "Beg": 480, "End": 611, "ID": "IPR00...
MGFDNPRSERFEDDPEISKIPTTSGVKVKYHIDGTQIPEQSSKKSRKNETRNKFLKTRVLSRVFSEDYERVKKRVLVLDPRGQLIHRWNKIFLVACLVSLFVDPLFFYLPVVREEVCIDIGKTLEVILTVVRSFGDLFYIVQICMKFRTAYVAPSSKVFGRGELVLTYSKIALRYFSKGFWLDFIAALPLPQVLIWIIIPTLRGSTMANTKNVLRFFIIFQYIPRLYLIFPLSSQIVKATGVVTETAWAGAAYNLMLYMLASHILGACWYLLSIERQEACWKSVCNMEKSNCQYGFFNCHSIKDAPRVAWFIASNVTNLC...
Generate a protein sequence for a novel protein that integrates the following function keywords: Polyketide synthase, enoylreductase domain, Cinnamyl alcohol dehydrogenase-like, GroES-like superfamily, Alcohol dehydrogenase-like, C-terminal, Alcohol dehydrogenase-like, N-terminal, NAD(P)-binding domain superfamily, Alc...
[ { "Beg": 69, "End": 83, "ID": "IPR002328", "Name": "Alcohol dehydrogenase, zinc-type, conserved site", "Type": "Conserved_site" }, { "Beg": 18, "End": 182, "ID": "IPR011032", "Name": "GroES-like superfamily", "Type": "Homologous_superfamily" }, { "Beg": 192, "...
MGSIEVAERTTVGLAAKDPSGILTPYTYTLRNTGPDDVYIKIHYCGVCHSDLHQIKNDLGMSNYPMVPGHEVVGEVLEVGSNVTRFKVGEIVGVGLLVGCCKSCRACDSEIEQYCNKKIWSYNDVYTDGKITQGGFAESTVVEQKFVVKIPEGLAPEQVAPLLCAGVTVYSPLSHFGLKTPGLRGGILGLGGVGHMGVKVAKAFGHHVTVISSSDKKKKEALEDLGADSYLVSSDTVGMQEAADSLDYIIDTVPVGHPLEPYLSLLKIDGKLILMGVINTPLQFVTPMVMLGRKSITGSFVGSVKETEEMLEFWKEKGLS...
Generate a protein sequence for a novel protein that integrates the following function keywords: Globin-like superfamily, Phycobilisome, alpha/beta subunit, Phycobilisome, alpha/beta subunit superfamily. The designed protein sequence is
[ { "Beg": 1, "End": 176, "ID": "IPR009050", "Name": "Globin-like superfamily", "Type": "Homologous_superfamily" }, { "Beg": 7, "End": 176, "ID": "IPR012128", "Name": "Phycobilisome, alpha/beta subunit", "Type": "Family" }, { "Beg": 1, "End": 177, "ID": "IPR...
MLDAFSKVITSADGKAAYVGGADLQALKKFVSDGNKRMDAVNAIVSNASCIVSDAVSGMVCENPALIAPNGGVYSNRKMAACLRDAEIILRYVSYSLLSGDSSVLEDRCLNGLKETYASLGVPAAGNARAVAIMKATVNGFINNTAQQKKLSTPAGDCSALASEAGGYFDKVSSALA
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is...
[ { "Beg": 28, "End": 115, "ID": "IPR003599", "Name": "Immunoglobulin domain subtype", "Type": "Domain" }, { "Beg": 16, "End": 116, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 26, "End": 110, "ID": "IPR013106", "...
MEAPAQLLFLLLLWLPDTTREIVMTQSPPTLSLSPGERVTLSCRASQSVSSSYLTWYQQKPGQAPRLLIYGASTRATSIPARFSGSGSGTDFTLTISSLQPEDFAVYYCQQDYNLP
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 18, "End": 117, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 28, "End": 111, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 40, "End": 112, "ID": "IPR013106", "Na...
MDMRVPAQLLGLLLLWLPGVRFDIQMTQSPSFLSASVGDRVSIICWASEGISSNLAWYLQKPGKSPKLFLYDAKDLHPGVSSRFSGRGSGTDFTLTIISLKPEDFAAYYCKQDFSYP
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is...
[ { "Beg": 27, "End": 119, "ID": "IPR003599", "Name": "Immunoglobulin domain subtype", "Type": "Domain" }, { "Beg": 5, "End": 119, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 26, "End": 116, "ID": "IPR013106", "N...
MAWTPLLFLTLLLHCTGSLSQLVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQPEKGPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTWGTGI
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is...
[ { "Beg": 31, "End": 122, "ID": "IPR003599", "Name": "Immunoglobulin domain subtype", "Type": "Domain" }, { "Beg": 25, "End": 122, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 30, "End": 116, "ID": "IPR013106", "...
MSVPTMAWMMLLLGLLAYGSGVDSQTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQAPRTLIYSTNTRSSGVPDRFSGSILGNKAALTITGAQADDESDYYCVLYMGSGI
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is...
[ { "Beg": 28, "End": 120, "ID": "IPR003599", "Name": "Immunoglobulin domain subtype", "Type": "Domain" }, { "Beg": 23, "End": 120, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 27, "End": 118, "ID": "IPR013106", "...
MAWTPLLLLFPLLLHCTGSLSQPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWHQQQPGKAPRYLMKLEGSGSYNKGSGVPDRFSGSSSGADRYLTISNLQFEDEADYYCETWDSNT
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is...
[ { "Beg": 26, "End": 123, "ID": "IPR003599", "Name": "Immunoglobulin domain subtype", "Type": "Domain" }, { "Beg": 21, "End": 123, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 24, "End": 120, "ID": "IPR013106", "...
MALTPLLLLLLSHCTGSLSRPVLTQPPSLSASPGATARLPCTLSSDLSVGGKNMFWYQQKLGSSPRLFLYHYSDSDKQLGPGVPSRVSGSKETSSNTAFLLISGLQPEDEADYYCQVYESSAN
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 2, "End": 117, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 24, "End": 111, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 36, "End": 110, "ID": "IPR013106", "Nam...
MPWALLLLTLLTHSAVSVVQAGLTQPPSVSKGLRQTATLTCTGNSNIVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSALDSSLSA
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is...
[ { "Beg": 26, "End": 118, "ID": "IPR003599", "Name": "Immunoglobulin domain subtype", "Type": "Domain" }, { "Beg": 20, "End": 118, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 24, "End": 114, "ID": "IPR013106", "...
MAWSSLLLTLLAHCTGSWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYVVHWYQQLPGTAPKLLIYGNSNRPSGVPDQFSGSKSGTSASLAITGLQSEDEADYYCKAWDNSLNA
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 5, "End": 105, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 24, "End": 104, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 20, "End": 105, "ID": "IPR013783", "Nam...
MAWTPLLLLFLSHCTGSLSQAVLTQPTSLSASPGASARLTCTLRSGISVGSYRIYWYQQKPGSPPRYLLNYYSDSDKHQGSGVPSRFSGSKDASTNAGILFISGL
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is...
[ { "Beg": 26, "End": 117, "ID": "IPR003599", "Name": "Immunoglobulin domain subtype", "Type": "Domain" }, { "Beg": 15, "End": 117, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 25, "End": 111, "ID": "IPR013106", "...
MAWTPLFLFLLTCCPGSNSQAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPYWFQQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLLGAQPEDEAEYYCLLSYSGAR
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is...
[ { "Beg": 26, "End": 123, "ID": "IPR003599", "Name": "Immunoglobulin domain subtype", "Type": "Domain" }, { "Beg": 21, "End": 123, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 24, "End": 121, "ID": "IPR013106", "...
MAWTPLLLLLLSHCTGSLSQPVLTQPPSSSASPGESARLTCTLPSDINVGSYNIYWYQQKPGSPPRYLLYYYSDSDKGQGSGVPSRFSGSKDASANTGILLISGLQSEDEADYYCMIWPSNAS
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is...
[ { "Beg": 26, "End": 117, "ID": "IPR003599", "Name": "Immunoglobulin domain subtype", "Type": "Domain" }, { "Beg": 34, "End": 118, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 25, "End": 114, "ID": "IPR013106", "...
MAWALLLLTLLTQGTGSWAQSALTQPPFVSGAPGQSVTISCTGTSSDVGDYDHVFWYQKRLSTTSRLLIYNVNTRPSGISDLFSGSKSGNMASLTISGLKSEVEANYHCSLYSSSYTF
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is...
[ { "Beg": 26, "End": 114, "ID": "IPR003599", "Name": "Immunoglobulin domain subtype", "Type": "Domain" }, { "Beg": 9, "End": 115, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 27, "End": 108, "ID": "IPR013106", "N...
MAWATLLLPLLNLYTGSVASYELTQLPSVSVSPGQTARITCSGDVLGENYADWYQQKPGQAPELVIYEDSERYPGIPERFSGSTSGNTTTLTISRVLTEDEADYYCLSGDEDNPS
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is...
[ { "Beg": 26, "End": 117, "ID": "IPR003599", "Name": "Immunoglobulin domain subtype", "Type": "Domain" }, { "Beg": 20, "End": 118, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 24, "End": 114, "ID": "IPR013106", "...
MAWALLLLTLLTQGTGSWAQSALTQPPSVSGSPGQSVTISCTGTSSDVGSYNRVSWYQQPPGTAPKLMIYEVSNRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCSLYTSSSTF
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is...
[ { "Beg": 26, "End": 114, "ID": "IPR003599", "Name": "Immunoglobulin domain subtype", "Type": "Domain" }, { "Beg": 9, "End": 115, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 24, "End": 108, "ID": "IPR013106", "N...
MAWIPLLLPLLTLCTGSEASYELTQPPSVSVSLGQMARITCSGEALPKKYAYWYQQKPGQFPVLVIYKDSERPSGIPERFSGSSSGTIVTLTISGVQAEDEADYYCLSADSSGTY
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is...
[ { "Beg": 26, "End": 115, "ID": "IPR003599", "Name": "Immunoglobulin domain subtype", "Type": "Domain" }, { "Beg": 5, "End": 115, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 24, "End": 112, "ID": "IPR013106", "N...
MAWTPLLLSLLAHCTGSATSYELTQPHSVSVATAQMARITCGGNNIGSKAVHWYQQKPGQDPVLVIYSDSNRPSGIPERFSGSNPGNTATLTISRIEAGDEADYYCQVWDSSSDH
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is...
[ { "Beg": 26, "End": 114, "ID": "IPR003599", "Name": "Immunoglobulin domain subtype", "Type": "Domain" }, { "Beg": 9, "End": 115, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 24, "End": 110, "ID": "IPR013106", "N...
MAWTPLLLPLLTFCTVSEASYELTQPPSVSVSPGQTARITCSGDALPKKYAYWYQQKSGQAPVLVIYEDSKRPSGIPERFSGSSSGTMATLTISGAQVEDEADYYCYSTDSSGNH
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is...
[ { "Beg": 26, "End": 115, "ID": "IPR003599", "Name": "Immunoglobulin domain subtype", "Type": "Domain" }, { "Beg": 34, "End": 115, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 24, "End": 112, "ID": "IPR013106", "...
MAWTALLLSLLAHFTGSVASYELTQPLSVSVALGQTARITCGGNNIGSKNVHWYQQKPGQAPVLVIYRDSNRPSGIPERFSGSNSGNTATLTISRAQAGDEADYYCQVWDSSTAH
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is...
[ { "Beg": 26, "End": 122, "ID": "IPR003599", "Name": "Immunoglobulin domain subtype", "Type": "Domain" }, { "Beg": 21, "End": 122, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 24, "End": 112, "ID": "IPR013106", "...
MAWVSFYLLPFIFSTGLCALPVLTQPPSASALLGASIKLTCTLSSEHSTYTIEWYQQRPGRSPQYIMKVKSDGSHSKGDGIPDRFMGSSSGADRYLTFSNLQSDDEAEYHCGESHTIDGQVG
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin-like fold, T cell receptor gamma variable/constant region. The designed protein sequence is
[ { "Beg": 17, "End": 119, "ID": "IPR013783", "Name": "Immunoglobulin-like fold", "Type": "Homologous_superfamily" }, { "Beg": 26, "End": 117, "ID": "IPR036179", "Name": "Immunoglobulin-like domain superfamily", "Type": "Homologous_superfamily" }, { "Beg": 6, "E...
MPLVVAVIFFSLWVFALGQLEQPEISISRPANKSAHISWKASIQGFSSKIIHWYWQKPNKGLEYLLHVFLTISAQDCSGGKTKKLEVSKNAHTSTSTLKIKFLEKEDEVVYHCACWIRH
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin-like fold, Immunoglobulin V-set domain, T cell receptor beta variable. The designed protein sequence is
[ { "Beg": 25, "End": 110, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 12, "End": 115, "ID": "IPR013783", "Name": "Immunoglobulin-like fold", "Type": "Homologous_superfamily" }, { "Beg": 23, "End": 110, "ID": "IPR03...
MGTRLLCWAALCLLGADHTGAGVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGAADDSGLPKDRFFAVRPEGSVSTLKIQRTEQGDSAAYLRASSL
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, T cell receptor beta variable, Immunoglobulin-like domain, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 34, "End": 114, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 25, "End": 111, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 37, "End": 112, "ID": "IPR013106", "Na...
MSNQVLCCVVLCLLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSI
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, T cell receptor beta variable, Immunoglobulin-like domain, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 10, "End": 111, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 21, "End": 109, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 32, "End": 110, "ID": "IPR013106", "Na...
MLLLLLLLGPGSGLGAVVSQHPSRVICKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSAR
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, T cell receptor beta variable, Immunoglobulin-like domain, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 21, "End": 115, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 25, "End": 111, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 37, "End": 112, "ID": "IPR013106", "Na...
MASLLFFCGAFYLLGTGSMDADVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLQLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSDL
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, T cell receptor beta variable, Immunoglobulin-like domain, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 21, "End": 114, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 25, "End": 111, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 19, "End": 114, "ID": "IPR013783", "Na...
MTIRLLCYVGFYFLGAGLMEADIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 20, "End": 120, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 26, "End": 114, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 38, "End": 115, "ID": "IPR013106", "Na...
MRLPAQLLGLLMLWVSGSSGDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Heavy Variable, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 32, "End": 118, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 31, "End": 117, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 37, "End": 118, "ID": "IPR013106", "Na...
MMEFGLSWVFLVAIFKGVQCEVQLVESGEGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDMAVYYCAR
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, T cell receptor gamma variable/constant region, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 14, "End": 118, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 28, "End": 115, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 18, "End": 118, "ID": "IPR013783", "Na...
MQWALAVLLAFLSPASQKSSNLEGRTKSVIRQTGSSAEITCDLAEGSNGYIHWYLHQEGKAPQRLQYYDSYNSKVVLESGVSPGKYYTYASTRNNLRLILRNLIENDFGVYYCATWDG
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Heavy Variable, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 14, "End": 117, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 30, "End": 116, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 36, "End": 117, "ID": "IPR013106", "Na...
MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSGTLSLTCAVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSTNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCAR
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 16, "End": 120, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 26, "End": 114, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 38, "End": 115, "ID": "IPR013106", "Na...
MRLLAQLLGLLMLWVPGSSGDIVMTQTPLSSPVTLGQPASISFRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIYKVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCTQATQFP
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is...
[ { "Beg": 28, "End": 119, "ID": "IPR003599", "Name": "Immunoglobulin domain subtype", "Type": "Domain" }, { "Beg": 16, "End": 120, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 26, "End": 114, "ID": "IPR013106", "...
MRLPAQLLGLLMLWIPGSSADIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQPPQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIQLP
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is...
[ { "Beg": 30, "End": 116, "ID": "IPR003599", "Name": "Immunoglobulin domain subtype", "Type": "Domain" }, { "Beg": 18, "End": 117, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 28, "End": 111, "ID": "IPR013106", "...
MDMRVPAQLLGLLLLWFPGARCNIQMTQSPSAMSASVGDRVTITCRARQGISNYLAWFQQKPGKVPKHLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYP
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is...
[ { "Beg": 30, "End": 115, "ID": "IPR003599", "Name": "Immunoglobulin domain subtype", "Type": "Domain" }, { "Beg": 18, "End": 117, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 28, "End": 112, "ID": "IPR013106", "...
MDMRVPAQLLGLLLLWLPDTRCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYNSAP
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 16, "End": 120, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 26, "End": 114, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 38, "End": 115, "ID": "IPR013106", "Na...
MRLPAQLLGLLMLWVPGSSGDVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNWFQQRPGQSPRRLIYKVSNWDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWP
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 24, "End": 117, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 28, "End": 109, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 40, "End": 112, "ID": "IPR013106", "Na...
MDMRVPAQLLGLLLLWVPGARCDIQLTQSPSSLSASVGDRVTITCRVSQGISSYLNWYRQKPGKVPKLLIYSASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYGQRTYNAP
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, T cell receptor variable domain, Immunoglobulin-like domain, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 23, "End": 113, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 27, "End": 112, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 39, "End": 112, "ID": "IPR013106", "Na...
MKSLRVLLVILWLQLSWVWSQQKEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVN
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, T cell receptor variable domain, Immunoglobulin-like domain, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 41, "End": 132, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 45, "End": 130, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 57, "End": 131, "ID": "IPR013106", "Na...
MAFWLRSLGLHFRPHLGRRMESFLGGVLLILWLQVDWVKSQKIEQNSEALNIQEGKTATLTCNYTNYSPAYLQWYRQDPGRGPVFLLLIRENEKEKRKERLKVTFDTTLKQSLFHITASQPADSATYLCALD
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, T cell receptor variable region, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 7, "End": 112, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 25, "End": 110, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 20, "End": 112, "ID": "IPR013783", "Nam...
MNSSPGPAIALFLMFGGINGDSVVQTEGQVLPSEGDSLIVNCSYETTQYPSLFWYVQYPGEGPQLHLKAMKANDKGRNKGFEAMYRKETTSFHLEKDSVQESDSAVYFCALS
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, T cell receptor alpha variable region, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 36, "End": 112, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 35, "End": 111, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 39, "End": 111, "ID": "IPR013106", "Na...
MEKMRRPVLIIFCLCLGWANGENQVEHSPHFLGPQQGDVASMSCTYSVSRFNNLQWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDSATYFCAVD
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, T cell receptor variable domain, Immunoglobulin-like domain, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 23, "End": 113, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 27, "End": 112, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 39, "End": 112, "ID": "IPR013106", "Na...
MMKCPQALLAIFWLLLSWVSSEDKVVQSPLSLVVHEGDTVTLNCSYEVTNFRSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSSILDKKELFSILNITATQTGDSAIYLCAVE
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, T cell receptor variable domain, Immunoglobulin-like domain, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 30, "End": 121, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 34, "End": 119, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 46, "End": 120, "ID": "IPR013106", "Na...
MDKILGASFLVLWLQLCWVSGQQKEKSDQQQVKQSPQSLIVQKGGISIINCAYENTAFDYFPWYQQFPGKGPALLIAIRPDVSEKKEGRFTISFNKSAKQFSSHIMDSQPGDSATYFCAAS
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, T cell receptor variable region, Immunoglobulin-like fold. The designed protein sequence is
[ { "Beg": 21, "End": 111, "ID": "IPR007110", "Name": "Immunoglobulin-like domain", "Type": "Domain" }, { "Beg": 25, "End": 109, "ID": "IPR013106", "Name": "Immunoglobulin V-set domain", "Type": "Domain" }, { "Beg": 37, "End": 110, "ID": "IPR013106", "Na...
MLSASCSGLVILLIFRRTSGDSVTQTEGPVTLPERAALTLNCTYQSSYSTFLFWYVQYLNKEPELLLKSSENQETDSRGFQASPIKSDSSFHLEKPSVQLSDSAVYYCALR
Generate a protein sequence for a novel protein that integrates the following function keywords: Major Intrinsic Protein/Aquaporin, Major intrinsic protein, Aquaporin-like. The designed protein sequence is
[ { "Beg": 35, "End": 276, "ID": "IPR000425", "Name": "Major intrinsic protein", "Type": "Family" }, { "Beg": 39, "End": 58, "ID": "IPR000425", "Name": "Major intrinsic protein", "Type": "Family" }, { "Beg": 78, "End": 102, "ID": "IPR000425", "Name": "Ma...
MVQASGHRRSTRGSKMVSWSVIAKIQEIWCEEDERKMVREFLAEFMSTYVMMVFGLGSVAHMVLNKTYGSYLGVNLGFGFGVTMGVHVAGRISGAHMNAAVTFTNCALGRVPWRKFPVHVLGQFLGSFLAAATIYSLFYTAILHFSGGELMVTGPFATAGIFATYLPDHMTLWRGFLNEEWLTRMLQLCLFTITDQENNPALPGTHALVISILVVIIRVSHGINTGYAINPSRDPPPSIFTFIAGWGKQVFSDGENWWWVPVVAPLLGASLGGIIYLVFIGSTIPREPLKLEDSVAYEDHGITVLPKMGSHEPMISPLTL...
Generate a protein sequence for a novel protein that integrates the following function keywords: Cyclophilin-like domain superfamily, Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain, Cyclophilin-type peptidyl-prolyl cis-trans isomerase, conserved site, Cyclophilin-type peptidyl-prolyl cis-trans isomerase. T...
[ { "Beg": 9, "End": 162, "ID": "IPR002130", "Name": "Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain", "Type": "Domain" }, { "Beg": 24, "End": 39, "ID": "IPR002130", "Name": "Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain", "Type": "Domain" }, ...
MVNSVVFFEITRDGKPLGRISIKLFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTRPNGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICAAKTEWLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKITIADCGQF
Generate a protein sequence for a novel protein that integrates the following function keywords: Cyclophilin-like domain superfamily, Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain, Cyclophilin-type peptidyl-prolyl cis-trans isomerase, conserved site, Cyclophilin-type peptidyl-prolyl cis-trans isomerase. T...
[ { "Beg": 7, "End": 162, "ID": "IPR002130", "Name": "Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain", "Type": "Domain" }, { "Beg": 24, "End": 39, "ID": "IPR002130", "Name": "Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain", "Type": "Domain" }, ...
MVNSVVFFDITVDGKPLGRISIKLFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTRPNGTDDKSIYGEKFDDENLIRKHTGSGILSMVNAGPNTNGSQLFICTAKTEWLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKITIADCGQF
Generate a protein sequence for a novel protein that integrates the following function keywords: Flavin Monoamine Oxidase, Flavin amine oxidase, Amine oxidase, FAD/NAD(P)-binding domain superfamily. The designed protein sequence is
[ { "Beg": 7, "End": 26, "ID": "IPR001613", "Name": "Flavin amine oxidase", "Type": "Family" }, { "Beg": 411, "End": 428, "ID": "IPR001613", "Name": "Flavin amine oxidase", "Type": "Family" }, { "Beg": 15, "End": 429, "ID": "IPR002937", "Name": "Amine ox...
MTEKIYDAIVVGAGFSGLVAARELSAQGRSVLIIEARHRLGGRTHVVNFLGRPVEIGGAGVHWCQPHVFAEMQRYGFGFKEAPLADLDKAYMVFADGQKIDVPPATFDEEYTTAFEKFCSRSRELFPRPYSPLDNHEVSNLDGVSARDHLESLGLNELQLASMNAELTLYGGAPTTELSYPSFVKFHALASWDTITFTDSEKRYHVQGGTNALCQAIFDDCRADSEFGVPVEAVAQTDNGVTVTLADKRVFRALTCVLTLPTKVYADVRFEPPLPPEKRAFIEHAEMADGAELYVHVRQNLGNTFTFCDDPNPFNAVQTY...
Generate a protein sequence for a novel protein that integrates the following function keywords: Methyltransferase type 11, S-adenosyl-L-methionine-dependent methyltransferase superfamily, Erg6/SMT methyltransferase, SAM-dependent methyltransferase gTMT-type. The designed protein sequence is
[ { "Beg": 72, "End": 169, "ID": "IPR013216", "Name": "Methyltransferase type 11", "Type": "Domain" }, { "Beg": 1, "End": 290, "ID": "IPR025774", "Name": "SAM-dependent methyltransferase gTMT-type", "Type": "Family" }, { "Beg": 10, "End": 288, "ID": "IPR0290...
MAEKQQAVAEFYDNSTGAWEVFFGDHLHDGFYDPGTTATIAGSRAAVVRMIDEALRFANISDDPAKKPKTMLDVGCGIGGTCLHVAKKYGIQCKGITISSEQVKCAQGFAEEQGLEKKVSFDVGDALDMPYKDGTFDLVFTIQCIEHIQDKEKFIREMVRVAAPGAPIVIVSYAHRNLSPSEGSLKPEEKKVLKKICDNIVLSWVCSSADYVRWLTPLPVEDIKAADWTQNITPFYPLLMKEAFTWKGFTSLLMKGGWSAIKVVLAVRMMAKAADDGVLKFVAVTCRKSK
Generate a protein sequence for a novel protein that integrates the following function keywords: Methyltransferase type 11, S-adenosyl-L-methionine-dependent methyltransferase superfamily, Erg6/SMT methyltransferase, SAM-dependent methyltransferase gTMT-type. The designed protein sequence is
[ { "Beg": 104, "End": 201, "ID": "IPR013216", "Name": "Methyltransferase type 11", "Type": "Domain" }, { "Beg": 24, "End": 322, "ID": "IPR025774", "Name": "SAM-dependent methyltransferase gTMT-type", "Type": "Family" }, { "Beg": 15, "End": 289, "ID": "IPR02...
MYTCSIIIYILTFWQLSKIKKQVAAAEKQVMTVTEKQEAVAEFYDKSTDAWEVFFGEHLHDGFYEPGTTATIPGSKVAVVRMIDELLRFAGISDDPEKKPKTMLDVGCGLGGTCLHVAKKYDIKCTGITISPEQVKCAQDLAATQGLESKVSFDVGDALDMPYKDGTFDLVFTIQCIEHIQDKEKFIREMVRVAAPGAPVVIAGYAARNLSPSEESLKPEEKMVLEKICDHIVLSWLCSTGDYVKWLTPLPVQDIKVWDLTQNITPFYPLCIKEAFTWKSFTSLLKMGGWSAIKVVFAVKMMAMAAEEGLLKFAAVTCRK...
Generate a protein sequence for a novel protein that integrates the following function keywords: Aldolase-type TIM barrel, Transaldolase, active site, Transaldolase/Fructose-6-phosphate aldolase, Transaldolase type 1. The designed protein sequence is
[ { "Beg": 15, "End": 315, "ID": "IPR001585", "Name": "Transaldolase/Fructose-6-phosphate aldolase", "Type": "Family" }, { "Beg": 2, "End": 321, "ID": "IPR001585", "Name": "Transaldolase/Fructose-6-phosphate aldolase", "Type": "Family" }, { "Beg": 4, "End": 322,...
MSSSLEQLKATGTTVVSDSGDFVSIGKYKPQDATTNPSLILAASKKAEYAKLIDVAIDYAKQKGGSIDQQVDDALDRLLVEFGKEILKIIPGKVSTEVDARYSFDTEASVNKALHLIELYGEQGISKDRILIKIAATWEGIKAAEILQRDHGINTNLTLMFSLVQAIGAAEAGAYLISPFVGRILDWFKASTKKEYSKEEDPGVQSVKTIFNYYKKYGYNTIVMGASFRNTGEITELAGCDYLTISPNLLEDLLNSNEPVPKKLDASQAASLDIEKKSYINDEALFRFDFNEDQMAVEKLREGISKFAADAVTLKSILKE...
Generate a protein sequence for a novel protein that integrates the following function keywords: Bulb-type lectin domain, Serine/threonine-protein kinase, active site, Protein kinase-like domain superfamily, S-receptor-like serine/threonine-protein kinase, Bulb-type lectin domain superfamily, G-type lectin S-receptor-l...
[ { "Beg": 526, "End": 791, "ID": "IPR000719", "Name": "Protein kinase domain", "Type": "Domain" }, { "Beg": 523, "End": 797, "ID": "IPR000719", "Name": "Protein kinase domain", "Type": "Domain" }, { "Beg": 523, "End": 797, "ID": "IPR000719", "Name": "Pr...
MVALLLFPMLLQLLSPTCAQTQKNITLGSTLAPQGPASSWLSPSGDFAFGFRPVEGNTSFYLIAVWFNKISDKTVVWYAKNTDQDPSIVEVPSDSFLQLTNDGALSLKDRSGQEGWNPQVTGVAYASMRDTGNFVLLGADGTTKWQTFDMPSDTILPTQVIPCNKTRNKSLRARLDIDDYSSGRFLLDVQTDGNLALYLVAVPSGSKYQQYWSTDTTGNGSELVFSETGKVYFALTDGTQINISSDAGIGSMADYFHRATLDPDGVFRQYVYPKKANAGILGGETWTALSMQPQNICHAIVSDVGSGVCGFNSYCTFDGT...
Generate a protein sequence for a novel protein that integrates the following function keywords: C2 domain superfamily, Synaptotagmin, C2 domain. The designed protein sequence is
[ { "Beg": 157, "End": 262, "ID": "IPR000008", "Name": "C2 domain", "Type": "Domain" }, { "Beg": 287, "End": 392, "ID": "IPR000008", "Name": "C2 domain", "Type": "Domain" }, { "Beg": 173, "End": 185, "ID": "IPR000008", "Name": "C2 domain", "Type": "D...
MVSESHHEALAAPPATTVAAAPPSNVTEPASPGGGGGKEDAFSKLKEKFMNELNKIPLPPWALIAIAIVAVLLILTCCFCLCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQDDDAETGLTDGEEKEEPKEVEKLGKIQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEYKVAMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNG...
Generate a protein sequence for a novel protein that integrates the following function keywords: Terpene synthase-like, Isoprenoid synthase domain superfamily, Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid, Terpene synthase, N-terminal domain superfamily, Terpene synthase, N-terminal domain. The desig...
[ { "Beg": 273, "End": 481, "ID": "IPR001906", "Name": "Terpene synthase, N-terminal domain", "Type": "Domain" }, { "Beg": 113, "End": 299, "ID": "IPR008930", "Name": "Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid", "Type": "Homologous_superfamily" }, ...
MSMTLFASVTRPGLPGPTALRFPETRHLFHSVTAFAASFSPSKSSVGSSQCNATTPPAEYKEYTGNDLAKTTVDGIEKDIHSNKGLSDKTRELVMSIRSILRTMEEGEISMSPYDTAWVAMVEDIDGGGGPHFPSTLDWISSNQLADGSWGDPIFLVYDRLINTFACVIALTSWKMHPDKCDKAISFIRENMYKLDDEKEERMPIGFEMTFPPLVEKAKRLNINFPDDSPGLRKIYAQRDLKFKRIPWDKMHTVPTTLLYSLEGMALEADVLDWQKLLKLQSPDGSLFYSPASTAFALQQTGDHNCLQYLLKLVQTFNGG...
Generate a protein sequence for a novel protein that integrates the following function keywords: Terpene synthase-like, Isoprenoid synthase domain superfamily, Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid, Terpene synthase, N-terminal domain superfamily, Terpene synthase, N-terminal domain. The desig...
[ { "Beg": 265, "End": 469, "ID": "IPR001906", "Name": "Terpene synthase, N-terminal domain", "Type": "Domain" }, { "Beg": 84, "End": 389, "ID": "IPR008930", "Name": "Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid", "Type": "Homologous_superfamily" }, {...
MGSLSTLNLIKTCVTLASSEKLNQPSQCYTISTCMKSSNNPPFNYYQINGRKKMSTAIDSSVNAPPEQKYNSTALEHDTEIIEIEDHIECIRRLLRTAGDGRISVSPYDTAWIALIKDLDGHDSPQFPSSMEWVADNQLPDGSWGDEHFVCVYDRLVNTIACVVALRSWNVHAHKCEKGIKYIKENVHKLEDANEEHMTCGFEVVFPALLQRAQSMGIKGIPYNAPVIEEIYNSREKKLKRIPMEVVHKVATSLLFSLEGLENLEWEKLLKLQSPDGSFLTSPSSTAFAFIHTKDRKCFNFINNIVHTFKGGAPHTYPVD...
Generate a protein sequence for a novel protein that integrates the following function keywords: Terpene synthase-like, Isoprenoid synthase domain superfamily, Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid, Terpene synthase, N-terminal domain superfamily, Terpene synthase, N-terminal domain. The desig...
[ { "Beg": 266, "End": 455, "ID": "IPR001906", "Name": "Terpene synthase, N-terminal domain", "Type": "Domain" }, { "Beg": 107, "End": 188, "ID": "IPR008930", "Name": "Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid", "Type": "Homologous_superfamily" }, ...
MASTPTLNLSITTPFVRTKIPAKISLPACSWLDRSSSRHVELNHKFCRKLELKVAMCRASLDVQQVRDEVYSNAQPHELVDKKIEERVKYVKNLLSTMDDGRINWSAYDTAWISLIKDFEGRDCPQFPSTLERIAENQLPDGSWGDKDFDCSYDRIINTLACVVALTTWNVHPEINQKGIRYLKENMRKLEETPTVLMTCAFEVVFPALLKKARNLGIHDLPYDMPIVKEICKIGDEKLARIPKKMMEKETTSLMYAAEGVENLDWERLLKLRTPENGSFLSSPAATVVAFMHTKDEDCLRYIKYLLNKFNGGAPNVYPV...
Generate a protein sequence for a novel protein that integrates the following function keywords: Terpene synthase-like, Isoprenoid synthase domain superfamily, Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid, Terpene synthase, N-terminal domain superfamily, Terpene synthase, N-terminal domain, Terpene s...
[ { "Beg": 46, "End": 208, "ID": "IPR001906", "Name": "Terpene synthase, N-terminal domain", "Type": "Domain" }, { "Beg": 275, "End": 514, "ID": "IPR005630", "Name": "Terpene synthase, metal-binding domain", "Type": "Domain" }, { "Beg": 62, "End": 230, "ID":...
MSITFNLKIAPFSGPGIQRSKETFPATEIQITASTKSTMTTKCSFNASTDFMGKLREKVGGKADKPPVVIHPVDISSNLCMIDTLQSLGVDRYFQSEINTLLEHTYRLWKEKKKNIIFKDVSCCAIAFRLLREKGYQVSSDKLAPFADYRIRDVATILELYRASQARLYEDEHTLEKLHDWSSNLLKQHLLNGSIPDHKLHKQVEYFLKNYHGILDRVAVRRSLDLYNINHHHRIPDVADGFPKEDFLEYSMQDFNICQAQQQEELHQLQRWYADCRLDTLNYGRDVVRIANFLTSAIFGEPEFSDARLAFAKHIILVTR...
Generate a protein sequence for a novel protein that integrates the following function keywords: Terpene synthase-like, Isoprenoid synthase domain superfamily, Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid, Terpene synthase, N-terminal domain superfamily, Terpene synthase, N-terminal domain, Terpene c...
[ { "Beg": 203, "End": 389, "ID": "IPR001906", "Name": "Terpene synthase, N-terminal domain", "Type": "Domain" }, { "Beg": 462, "End": 697, "ID": "IPR005630", "Name": "Terpene synthase, metal-binding domain", "Type": "Domain" }, { "Beg": 47, "End": 235, "ID"...
IDESQTSLDTGVQRFTSSKIASSVQCFEDTKARIVKLIHKPELSVSTYDTAWVAMVPSPNSSNEPCFPDCLAWLLENQCCDGSWACPHHHPFLKKDVLSSTLACILALKKWGVGEEQINKGARFIEVNFASATEKSQISPTGFDIIFPAMLDYARDLFLDLRLEPTTFDNLIFRRDLELKRCYESHREAYLAYIAEGMGKLQDWESVMKYQRKNGSLFNSPSTTAAAFIALPNSGCLSYLHSALKKFGNAVPAAYPLDVYSRLRTVDNLESLGISRYFQKEIQQVLDETYRWWLQGSEEIFLDASTCALAFRTLRMNGYN...
Generate a protein sequence for a novel protein that integrates the following function keywords: L-gulonolactone/D-arabinono-1,4-lactone oxidase-like, FAD linked oxidase, N-terminal, D-arabinono-1,4-lactone oxidase, C-terminal domain, FAD-binding, type PCMH-like superfamily, Vanillyl-alcohol oxidase, C-terminal subdoma...
[ { "Beg": 18, "End": 141, "ID": "IPR006094", "Name": "FAD linked oxidase, N-terminal", "Type": "Domain" }, { "Beg": 233, "End": 466, "ID": "IPR007173", "Name": "D-arabinono-1,4-lactone oxidase, C-terminal domain", "Type": "Domain" }, { "Beg": 1, "End": 334, ...
MAQGAQRKNFGHNQILRPSAAYTPVDEQEVLQILDRHRGQRIRAVGRLHSWSEAVTGDGVLLDLQRLNDVRLQSDGDQLVATVGAGCQIKRLLKELNREGATLHSLGLITAQTIAGAISTGTHGSGRNSMSHYVVGVRLACYDASTGQAIIEELSAGEPLQAARCSLGSLGIILAVRIRCREQYNVQEHFTESRRLLDVMDAEAPFPLQQFYLLPWRWSYFIQHRREDDRPRSRLARLYRLYWLGTMDYGLILQILFLERVARSRRLIRLAFRRIIPAFLIRNWRVTDRSSSMLVMRHDAFRHIEIELFVRRDQLADALG...
Generate a protein sequence for a novel protein that integrates the following function keywords: Translation Initiation factor eIF- 4e-like, Eukaryotic translation initiation factor 4E (eIF-4E), conserved site, Translation Initiation factor eIF- 4e. The designed protein sequence is
[ { "Beg": 48, "End": 200, "ID": "IPR001040", "Name": "Translation Initiation factor eIF- 4e", "Type": "Family" }, { "Beg": 14, "End": 210, "ID": "IPR001040", "Name": "Translation Initiation factor eIF- 4e", "Type": "Family" }, { "Beg": 103, "End": 126, "ID"...
MVDEVEKPASLEESKTNTREVEEGAEEVIESDDTMSSLGNPCKAMKHPLEHSWTFWFDNPSGKSKQAAWGSSIRPIYTFSTVEDFWSVYNNIHHPSKLAVGADFHCFKNKIEPKWEDPVCASGGKWTMSFSRGKSDTCWLYTLLAMIGEQFDCGDEICGAVINVRVRQEKIALWTRNAANETAQVSIGKQWKEFLDYNDSIGFIFHDDAKKLDRAAKNRYSV
Generate a protein sequence for a novel protein that integrates the following function keywords: Metal-dependent hydrolase, composite domain superfamily, Metallo-dependent Hydrolase Enzymes, Amidohydrolase-related, Metal-dependent hydrolase. The designed protein sequence is
[ { "Beg": 102, "End": 462, "ID": "IPR006680", "Name": "Amidohydrolase-related", "Type": "Domain" }, { "Beg": 50, "End": 115, "ID": "IPR011059", "Name": "Metal-dependent hydrolase, composite domain superfamily", "Type": "Homologous_superfamily" }, { "Beg": 390, ...
MVRRIASATPMVQSPMSPLGTTYCVRPNPVSLNLQRRPLVIASTDEAKVTIIYAGLLIPGDGEPLRNAALVISDKIIAFVGSEADIPKKYLRSTQSTHRVPVLMPGLWDCHMHFGGDDDYYNDYTSGLATHPASSGARLARGCWEALQNGYTSYRDLAGYGCEVAKAINDGTIVGPNVYSSGAALSQTAGHGDIFALPAGEVLGSYGVMNPRPGYWGAGPLCIADGVEEVRRAVRLQIRRGAKVIKVMASGGVMSRDDNPNFAQFSPEELKVIVEEAARQNRIVSAHVHGKAGIMAAIKAGCKSLEHVSYADEEVWELMK...
Generate a protein sequence for a novel protein that integrates the following function keywords: Polyketide synthase, enoylreductase domain, GroES-like superfamily, Alcohol dehydrogenase-like, C-terminal, Alcohol dehydrogenase-like, N-terminal, NAD(P)-binding domain superfamily. The designed protein sequence is
[ { "Beg": 4, "End": 186, "ID": "IPR011032", "Name": "GroES-like superfamily", "Type": "Homologous_superfamily" }, { "Beg": 181, "End": 301, "ID": "IPR013149", "Name": "Alcohol dehydrogenase-like, C-terminal", "Type": "Domain" }, { "Beg": 33, "End": 142, "ID...
MASTTPSTYKQAVFKEQGAGLTLEEVALTLPKRDEILVKVEACGVCHSDHFAQTNLMGGGFPLVPGHEIIGRVAAVGEGETVWKEGDRIGGAWHGGHDGTCGACKKGFFQMCDNEQVNGISRNGGYAEYCIIRREAAVHIPDHVNAAKYAPMLCAGVTVFNAMRHMKIPPGELVAIQGLGGLGHLALQYANKFGYRVVALSRDSTKEEFARKLGAHEYIDTSREDPVAALQKLGGASLIVSTAPVPEIINPLIQGLGVMGKLLILSIVGGIEVHTGLLVGKGKSIWSWPSGHATDSEDAIAFADLHGIDCLIEEFPLDKC...
Generate a protein sequence for a novel protein that integrates the following function keywords: Cytochrome P450, Cytochrome P450 superfamily, Cytochrome P450 monooxygenase, fungi, Cytochrome P450, E-class, group I. The designed protein sequence is
[ { "Beg": 39, "End": 482, "ID": "IPR001128", "Name": "Cytochrome P450", "Type": "Family" }, { "Beg": 67, "End": 86, "ID": "IPR002401", "Name": "Cytochrome P450, E-class, group I", "Type": "Family" }, { "Beg": 91, "End": 112, "ID": "IPR002401", "Name": "...
MDILQLAPTHLLAILLSSTSALFLITYLLRAGHRPSDLPNGPPTVPLFGNELQVPKSDAHFQFSRWAKEYGGFFTLKRYNNTTIVISDQKLIKTLLDKKSNIYSHRPASLVSHLITQSDHLLVMQYGERWRMLRKTIHQYFMEPRCERDHWKVQEAEAKQMLHDYLTMPEDHMLHPKRYSNSITNSLVFGIRTKTVHDEYMKKLFYLMDKWSLVQELGATPPVDSFALLRYVPQWMLGNWRNRAVEVGDLMQSLYQTVLDQVKERRQRGIQRDSFMDRVLDTLKQTPLSENELRFLGGVLMEGGSDTSSSLILTIIQAMT...
Generate a protein sequence for a novel protein that integrates the following function keywords: NTF2-like domain superfamily. The designed protein sequence is
[ { "Beg": 55, "End": 180, "ID": "IPR032710", "Name": "NTF2-like domain superfamily", "Type": "Homologous_superfamily" } ]
MKSSLWVSLAVSLIGLGPAAARNDYPGNYPSSSPPLGPTDWERTPVSVFAKVLNTQPDPDYNLLKELVTYDCTYISLTFDNPTLHGIMPWAGTHTHVGPQAFIDIFTRVGLYWDRGPFSIDHIFGDDGNVTAWGSFTATSRTLGKTVISPWAARARVNSANQIFEFQWMEDTFTTASSFGSDNSTKVFIANPEGGTAHA
Generate a protein sequence for a novel protein that integrates the following function keywords: FAD linked oxidase, N-terminal, FAD-binding, type PCMH-like superfamily, Berberine/berberine-like, FAD-binding domain, PCMH-type, FAD-linked Oxidoreductases in Biosynthesis Pathways, FAD-binding, type PCMH, subdomain 2. The...
[ { "Beg": 122, "End": 261, "ID": "IPR006094", "Name": "FAD linked oxidase, N-terminal", "Type": "Domain" }, { "Beg": 508, "End": 551, "ID": "IPR012951", "Name": "Berberine/berberine-like", "Type": "Domain" }, { "Beg": 115, "End": 294, "ID": "IPR016166", ...
MRLHQSPPRLLVCILSVLQVSAGLSSNCRCMPGDSCWPSLNDWARFNTSIGGRLVDTQPLGQPCHDPFYTASECNELKQQWTHPELHDASSSSIMSAAVANETCDAFTPRSKPCTLGAMVRYAVNASSPDDFVQTIRFSQERNIRLVIRNTGHDYAGKSTGAGALSIWTHSLKEIDFLNYTSAHYTGPAVRMTAGIQGTDINPAAHKKGLVIVGGECATVGPVGGFTQGGGHSALSSRFGLAADQVLEWEVVDGMGRLLTASPTQNPDLYWALSGGGGGTFGVVYAVTVKTFPDFAVTGVVLQFENIDPSSNRFFEAVGH...
Generate a protein sequence for a novel protein that integrates the following function keywords: RmlC-like cupin domain superfamily, RmlC-like jelly roll fold. The designed protein sequence is
[ { "Beg": 66, "End": 217, "ID": "IPR011051", "Name": "RmlC-like cupin domain superfamily", "Type": "Homologous_superfamily" }, { "Beg": 39, "End": 143, "ID": "IPR014710", "Name": "RmlC-like jelly roll fold", "Type": "Homologous_superfamily" } ]
MAPFVPYHYSAGQSTIVKFGGLLTTEFLEPPPGRCFLFRQTYRHTIEGSIPENLRKLINSPDRPKGPPPHFHQFQTEYFRVENGVLGISVDGVVRRITPEDGEISVKAGSVHNFFIHPDSPENMTVYLSASDSGNDYQLDRVFFENWYGYWHDALLHDGGIDWIQFLAIQDGGDAYTPAPAWVPFRRQVGYWTCVIVGRWIGGLLGYKPFFREYTTDWDFAVAKMKGSFFQRHLVHAAFEEEKSWTKQAELEPKGKPENAEFEPWTEDMSPAPLSLGPVAYEQGLFHGVQPGSVNGSNGHSTGVESKLEQLGSRAQRRVV...
Generate a protein sequence for a novel protein that integrates the following function keywords: Major facilitator superfamily, Major facilitator superfamily domain, MFS transporter superfamily. The designed protein sequence is
[ { "Beg": 54, "End": 438, "ID": "IPR011701", "Name": "Major facilitator superfamily", "Type": "Family" }, { "Beg": 49, "End": 545, "ID": "IPR020846", "Name": "Major facilitator superfamily domain", "Type": "Domain" }, { "Beg": 45, "End": 306, "ID": "IPR0362...
MSIDASPSESVLESQTPDRVDESIPIKAEETEKDAAPGRDIVGFRWLLVCIAVFSANLLYGLDNTIVADIQAPIAGDFNEYTRLGWLGVGFTLGSVVFILPLGKAYAIFDTKWLFLGCLTMFAAGSALCGAAPSMNAIIVGRVWAGAGGAGMYLGNLNLITILTTPKEQPVYVGLVGLIYGTGCILGPIIGGAFSDSSATWRWSFYLNLVIFGVMSPIYVFLLPSLPRPAGEGRSFFKKLVELDWVGTVLSAGMHISIILFIVFGGVEWSWTDGRNIALYVVSAVLTIAFVLSQYFCIGTTKQDRLFPGEFLRDPTMLLL...
Generate a protein sequence for a novel protein that integrates the following function keywords: Short-chain dehydrogenase/reductase SDR, NAD(P)-binding domain superfamily. The designed protein sequence is
[ { "Beg": 19, "End": 254, "ID": "IPR002347", "Name": "Short-chain dehydrogenase/reductase SDR", "Type": "Family" }, { "Beg": 11, "End": 28, "ID": "IPR002347", "Name": "Short-chain dehydrogenase/reductase SDR", "Type": "Family" }, { "Beg": 88, "End": 99, "ID...
MVLTTGLKGAHVLITGGTRGMGEAMVHKFLQEEANVSYCARTVTNTEYDDFYSTLAEGNTARAVGTAFDVASKDSLVKWVESSAERLGRIDVIIANASPMHMEGETEHWESSFAIDVMGFVELVKAATPYLEKSPQASIIVQSSFMGREFYRSPPAAYGPCKAAQLQHVQELSHFLGPKGIRVNAISPGPVLCKGGPWELYSKINPEWVEEQRLKIPLKRLGGPTEVANVAVFLASPLASFVSGTNMLVDGGIHVGTQF
Generate a protein sequence for a novel protein that integrates the following function keywords: Polyketide synthase, beta-ketoacyl synthase domain, ACP-like superfamily, Acyl transferase domain superfamily, Polyketide synthase, C-terminal extension, Beta-ketoacyl synthase, C-terminal, Polyketide synthase, dehydratase ...
[ { "Beg": 567, "End": 864, "ID": "IPR001227", "Name": "Acyl transferase domain superfamily", "Type": "Homologous_superfamily" }, { "Beg": 1729, "End": 1744, "ID": "IPR006162", "Name": "Phosphopantetheine attachment site", "Type": "PTM" }, { "Beg": 1704, "End": ...
MHSVSPSTYPSGGTSPAPADTPGTEYSEYEFSNDVAVVGMACRVAGGNHNPELLWQSLLSQKSAVGEIPEMRWEPYYRRDPRNAKELKKTTSRGYFLDRLEDFDCQFFGISPKEAEQMDPQQRVSLEVASEALEDAGIPAKSLSGSDTAVFWGVNSDDYSKLVLEDLPNVEAWMGIGTAYCGVPNRISYHLNLMGPSTAVDAACASSLVAVHHGVQAIRLGESQVAIVGGVNALCGPGLTRVLDKAGAISSDGSCKSFDDDAHGYARGEGAGALVLKSLHRALLDHDNVLAVIKGSAVAQDGKTNGIMAPNAKAQQLAAR...
Generate a protein sequence for a novel protein that integrates the following function keywords: Glucose-methanol-choline oxidoreductase, C-terminal, Glucose-methanol-choline oxidoreductase, N-terminal, Glucose-methanol-choline oxidoreductase, FAD/NAD(P)-binding domain superfamily. The designed protein sequence is
[ { "Beg": 52, "End": 368, "ID": "IPR000172", "Name": "Glucose-methanol-choline oxidoreductase, N-terminal", "Type": "Domain" }, { "Beg": 327, "End": 341, "ID": "IPR000172", "Name": "Glucose-methanol-choline oxidoreductase, N-terminal", "Type": "Domain" }, { "Beg": ...
MRLTSGIFHAAIAVAAVGAVLPEGPSSSKTHRNEYARRMLGSSFGIPKNQTFDYLVIGGGTAGLTIATRLAEQGVGSVAVIEAGGFYELNNGNLSQIPAQDAFYVGTDLDDWQPGIDWGFHTTPQAGAYDRVSHYARGKCLGGSSARNYMAYQRGTKAAHQRWADTVGDSSYTWEQFLPFFEKSLHFTPANDALRGANASVVSDPSVLGNGDGPLSVTYPHYAQAFATWAKHAFIEIGLQIRSGFQSGALLGQSYGLYTINATTMHRESSETSFLRKGLADPNLTVFQSALAKRIRFQDKRAVGVDVETMGRAYTLSARK...
Generate a protein sequence for a novel protein that integrates the following function keywords: Acetate Uptake Transporter, Acetate transporter GPR1/Ato2/SatP-like. The designed protein sequence is
[ { "Beg": 37, "End": 222, "ID": "IPR000791", "Name": "Acetate transporter GPR1/Ato2/SatP-like", "Type": "Family" }, { "Beg": 33, "End": 238, "ID": "IPR051633", "Name": "Acetate Uptake Transporter", "Type": "Family" } ]
MKLSAEGTVMASSEEAAQLSCDTSSSHARNSKEQDFQPTQQIGSPTALGMGAFAIAFTTLSMSLMEWRSAAITNAYIGNCFFTAGMGLVLVAQWELVRGNSFGHTVFGGFGLFNLAFGAINAPAFGVADAFKDDPAALNNAIGYFLLVWGIFVLFFTVAAMPMNLVYTGMLGTSQITYTLLAASYFSFADDHASAGLALKKAAGAFGFVSGLFAWYTVGHLMCQDALLFSFPLGDTSPLYARLQRKKRH
Generate a protein sequence for a novel protein that integrates the following function keywords: Cytochrome P450, Cytochrome P450 superfamily, Cytochrome P450 monooxygenase, fungi, Cytochrome P450, E-class, group I. The designed protein sequence is
[ { "Beg": 32, "End": 476, "ID": "IPR001128", "Name": "Cytochrome P450", "Type": "Family" }, { "Beg": 60, "End": 79, "ID": "IPR002401", "Name": "Cytochrome P450, E-class, group I", "Type": "Family" }, { "Beg": 84, "End": 105, "ID": "IPR002401", "Name": "...
MEPFLLLLLVLLPAIVLVRYAFTYGHRTSTMPIGPPTLPFIGNIHQITKKYTHIKFTEWAAQYGGLYMLKIGNGNMAVITDRRLVKEVLDRKSGIYSHRPHSFVSHDLITKGNHLLVMHYGDQWRTFRRLVHQHLMETMVENHHTKIVNAEAIQLVRDYMIDPEHHMAHPKRYSNSITNSIVFGIRTANREGANMRRLYKLMEEWSEVMETGATPPVDLFPWLKLLPQWLFNNYIDRAKAIGVQMETLYVDILNKVIKRREDGHNNGTFMDKVLDSQEKHNLPWHQLAFIGGVLMEGGSDTSSSLTLAIVQALIQNPDVQ...
Generate a protein sequence for a novel protein that integrates the following function keywords: 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase, Amidohydrolase-related, Metal-dependent hydrolase. The designed protein sequence is
[ { "Beg": 4, "End": 313, "ID": "IPR006680", "Name": "Amidohydrolase-related", "Type": "Domain" }, { "Beg": 1, "End": 315, "ID": "IPR032465", "Name": "2-amino-3-carboxymuconate-6-semialdehyde decarboxylase", "Type": "Family" }, { "Beg": 3, "End": 313, "ID": ...
MAKIDVHHHFYPPAMRQALDRAGGDPSGWYIPPWTLELDQDITRQMKVTTTILSVTAPGPGIEPDVTKAAALARSCNESAAAIRDAKPQQYGFFASVPSLFDTAAVLKEIEYACTTLRADGVTLFTRYGKGSNYLGHAAFRPIWADLSRRGAVVFIHPTHPVDTQLINTWLPQPMFDYPHETGRAAMDLLTSGILQDYPGCKIILSHAGGTLPYLIHRAATMLPLMPRTLGLSTEELVEAARTFYFDTAISSNPVTLKALFEFAAPGHVLFGSDFPNAPHDAILRFTNFLEAYELPEETKRQVDSGAALELFPRLKGILD...
Generate a protein sequence for a novel protein that integrates the following function keywords: Carboxylesterase type B, active site, Type-B Carboxylesterase/Lipase, Alpha/Beta hydrolase fold, Carboxylesterase, type B, Carboxylesterase type B, conserved site. The designed protein sequence is
[ { "Beg": 40, "End": 550, "ID": "IPR002018", "Name": "Carboxylesterase, type B", "Type": "Domain" }, { "Beg": 138, "End": 148, "ID": "IPR019819", "Name": "Carboxylesterase type B, conserved site", "Type": "Conserved_site" }, { "Beg": 250, "End": 265, "ID": ...
MQIINWASLLLVTWETVVAAELPIVDLGYQRHQAIGFNSTGRYYQFSNVRYAEPPLGPLRFSLPVSPRNRSHEVVNGKGLGNICPQSQACWFNVQGDFVSAVTAGSTFNFTAAYDQVYQQDECTKPRPVADQNPLESEDCLFLDVYVPEKVISKRRDGNGKSNPGAPVLVYFQDGAYVSGSKSDQNPSGLIATSREDGSTGIIYVGVNYRLGVFGWLSGQKFQSEGGLPNAGLYDERLALEWVQRHITKFGGDPSRVTVMGVSAGGGSITMQLTAYGRAIRPPFAQIIAQSPAWEPGTKTPAIEDDLLDSFLTLLNVSSL...
Generate a protein sequence for a novel protein that integrates the following function keywords: Fungal Secondary Metabolite Regulators, Zn(2)-C6 fungal-type DNA-binding domain superfamily, Zn(2)Cys(6) fungal-type DNA-binding domain, Transcription factor domain, fungi. The designed protein sequence is
[ { "Beg": 36, "End": 70, "ID": "IPR001138", "Name": "Zn(2)Cys(6) fungal-type DNA-binding domain", "Type": "Domain" }, { "Beg": 37, "End": 64, "ID": "IPR001138", "Name": "Zn(2)Cys(6) fungal-type DNA-binding domain", "Type": "Domain" }, { "Beg": 37, "End": 66, ...
MYSTFSANFDTTIDASRDRSATPVTAPRPKRNQVARACDWCRLNRVRCDDKQPCQNCQNRGGSCSNTKPQEATSLPAANREMQRLRNKVKDLQDQIAKLKEGAEIQAQTGFATPPLSDAAHTSFDFAELTNTTEGWQGLQQTGQIHYGPLSSSYFVSRISRYLSQALNEPIEDAKLEACMARFHYIAPSHQPSRWDASPASQADQPQDGTEEAEDLTRSQEEHFLNLLWQSFHCVYPILDEREFQQYYESLWSSSPDGMSTRKPSALVDVLLAVCMQYSSTFFVSDDNQQGDTDSEWQAKHANLASRTYYQRAQRLLQSE...
Generate a protein sequence for a novel protein that integrates the following function keywords: Pheophorbide a oxygenase, Rieske [2Fe-2S] iron-sulphur domain superfamily, Cholesterol 7-desaturase, Rieske [2Fe-2S] iron-sulphur domain. The designed protein sequence is
[ { "Beg": 292, "End": 385, "ID": "IPR013626", "Name": "Pheophorbide a oxygenase", "Type": "Domain" }, { "Beg": 76, "End": 159, "ID": "IPR017941", "Name": "Rieske [2Fe-2S] iron-sulphur domain", "Type": "Domain" }, { "Beg": 77, "End": 188, "ID": "IPR017941", ...
MEVLQASSLSFQLLRRHSRNNLINKFRNPSLPRIHMPRQNIDLKTFAAITPTVACPPSEPEIIPEKKEDKFEWYENWYPVASVCDLDKRRPHGRKVIGIDVVVWWDRKENAWKVFDDTCPHRLAPLSEGRIDQWGRLQCVYHGWCFDGAGACKFIPQAPHHGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIFLTKKPHYIPELDDPSFTCTMTTREVPYGYEILAENLMDPSHVPYAHYGILELEKVKESAKRDREGGHELEIRVGKIDVNGFSAKQVSADYYFVPPYLYYGRITPNTATKAIDVTLPVVPE...
Generate a protein sequence for a novel protein that integrates the following function keywords: Pheophorbide a oxygenase, Rieske [2Fe-2S] iron-sulphur domain superfamily, Cholesterol 7-desaturase, Rieske [2Fe-2S] iron-sulphur domain. The designed protein sequence is
[ { "Beg": 296, "End": 389, "ID": "IPR013626", "Name": "Pheophorbide a oxygenase", "Type": "Domain" }, { "Beg": 80, "End": 163, "ID": "IPR017941", "Name": "Rieske [2Fe-2S] iron-sulphur domain", "Type": "Domain" }, { "Beg": 81, "End": 192, "ID": "IPR017941", ...
MPFPMEVLQASSLSFPLLRRHSRNNLINKFRNPTLPRIDIPRQNIDLKTFAATTPTVACPPSDPEIIPEKKEDKFDWYENWYPVATVCDLDKRRPHGRKVIGIDVVVWWDRKENAWKVFDDTCPHRLAPLSEGRIDQWGRLQCVYHGWCFDGVGACKFIPQAPHDGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIYLTNKPHYIPELDDPSFTCTTITREVPYGYEILAENLMDPSHVPYAHYGILELEKVKESSKRDREGGHEMEISVGTIDVNGFSAKHVSADYYFVPPYVYYGRITPNAATKTKDATLP...
Generate a protein sequence for a novel protein that integrates the following function keywords: Spexin. The designed protein sequence is
[ { "Beg": 24, "End": 51, "ID": "IPR028126", "Name": "Spexin", "Type": "Family" }, { "Beg": 7, "End": 51, "ID": "IPR028126", "Name": "Spexin", "Type": "Family" } ]
MISRVWILWTLVLFLLVTESHCIQKSSLSKNWGPQSMLYLKGKHGRRFVPDIDDHFISNSGLKSWYAVFK
Generate a protein sequence for a novel protein that integrates the following function keywords: S-adenosyl-L-methionine-dependent methyltransferase superfamily, Cation-dependent O-methyltransferase, Class I-like SAM-dependent O-methyltransferase. The designed protein sequence is
[ { "Beg": 27, "End": 238, "ID": "IPR002935", "Name": "Class I-like SAM-dependent O-methyltransferase", "Type": "Family" }, { "Beg": 14, "End": 238, "ID": "IPR002935", "Name": "Class I-like SAM-dependent O-methyltransferase", "Type": "Family" }, { "Beg": 7, "End...
MGASIDDYCLIHKKILHSEDLLKYILETSAYPREHEQLKGLREVTEKHEWSSALVPADEGLFLSMLIKLMNAKRTIEIGVYTGYSLLTTALALPEDGKITAIDVNKSFFEIGLPFIQKAGVEHKINFIESEALPVLDQMLQETKEEDLYDYAFVDADKSNYANYHERLVKLVRIGGAILYDNTLWYGSVAYPEYPGLHPEEEVARLSFRNLNTFLAADPRVEISQVSIGDGVTICRRLY
Generate a protein sequence for a novel protein that integrates the following function keywords: S-adenosyl-L-methionine-dependent methyltransferase superfamily, Cation-dependent O-methyltransferase, Class I-like SAM-dependent O-methyltransferase. The designed protein sequence is
[ { "Beg": 27, "End": 238, "ID": "IPR002935", "Name": "Class I-like SAM-dependent O-methyltransferase", "Type": "Family" }, { "Beg": 14, "End": 238, "ID": "IPR002935", "Name": "Class I-like SAM-dependent O-methyltransferase", "Type": "Family" }, { "Beg": 7, "End...
MGASIDDYCLIHKKILHSEDLLKYILETSAYPREHEQLKGLREVTEKHEWSSALVPADEGLFLSMLLKLMNAKRTIEIGVYTGYSLLTTALALPEDGKITAIDVNKSFFEIGLPFIQKAGVEHKINFIESEALPVLDQMLQETKEEDLYDYAFVDADKSNYANYHERLVKLVRIGGAILYDNTLWYGSVAYPEYPGLHPEEEVARLSFRNLNTFLAADPRVEISQVSIGDGVTICRRLY
Generate a protein sequence for a novel protein that integrates the following function keywords: S-adenosyl-L-methionine-dependent methyltransferase superfamily, Cation-dependent O-methyltransferase, Class I-like SAM-dependent O-methyltransferase. The designed protein sequence is
[ { "Beg": 27, "End": 238, "ID": "IPR002935", "Name": "Class I-like SAM-dependent O-methyltransferase", "Type": "Family" }, { "Beg": 14, "End": 238, "ID": "IPR002935", "Name": "Class I-like SAM-dependent O-methyltransferase", "Type": "Family" }, { "Beg": 6, "End...
MGASIDDYSLVHKNILHSEDLLKYILETSAYPREHEQLKGLREVTEKHEWSSALVPADEGLFLSMLLKLMNAKRTIEIGVYTGYSLLTTALALPEDGKITAIDVNKSFFEIGLPFIQKAGVEHKINFIESEALPVLDQMLQETKEEDLYDYAFVDADKSNYANYHERLVKLVRIGGAILYDNTLWYGSVAYPEYPGLHPEEEVARLSFRNLNTFLAADPRVEISQVSIGDGVTICRRLY
Generate a protein sequence for a novel protein that integrates the following function keywords: S-adenosyl-L-methionine-dependent methyltransferase superfamily, Cation-dependent O-methyltransferase, Class I-like SAM-dependent O-methyltransferase. The designed protein sequence is
[ { "Beg": 27, "End": 238, "ID": "IPR002935", "Name": "Class I-like SAM-dependent O-methyltransferase", "Type": "Family" }, { "Beg": 14, "End": 238, "ID": "IPR002935", "Name": "Class I-like SAM-dependent O-methyltransferase", "Type": "Family" }, { "Beg": 6, "End...
MGASIDDYSLVHKNILHSEDLLKYILETSAYPREHEQLKGLREVTEKHEWSSALVPADEGLFLSMLLKLMNAKRTIEIGVYTGYSLLTTALALPEDGKITAIDVNKSYYEIGLPFIQKAGVEHKINFIESEALPVLDQMLEEMKEEDLYDYAFVDADKSNYANYHERLVKLVRIGGAILYDNTLWYGSVAYPEYPGLHPEEEVARLSFRNLNTFLAADPRVEISQVSIGDGVTICRRLY
Generate a protein sequence for a novel protein that integrates the following function keywords: S-adenosyl-L-methionine-dependent methyltransferase superfamily, Cation-dependent O-methyltransferase, Class I-like SAM-dependent O-methyltransferase. The designed protein sequence is
[ { "Beg": 27, "End": 237, "ID": "IPR002935", "Name": "Class I-like SAM-dependent O-methyltransferase", "Type": "Family" }, { "Beg": 14, "End": 238, "ID": "IPR002935", "Name": "Class I-like SAM-dependent O-methyltransferase", "Type": "Family" }, { "Beg": 6, "End...
MGASIDDYSLVHKNILHSEDLLKYILETSAYPREHEQLKGLREVTEKHEWSSALVPADEGLFLSMLLKLMNAKRTIEIGVYTGYSLLTTALALPEDGKITAIDVNKSFFEIGLPFIQKAGVEHKINFIESEALPVLDQMLQEMKEEDLYDYAFVDADKSNYANYHERLVKLVRIGGAILYDNTLWYGSVAYPEYPGLHPEEEVARLSFRNLNTFLAADPRVEISQVSIGDGVTIXRRLY
Generate a protein sequence for a novel protein that integrates the following function keywords: UbiA prenyltransferase, UbiA prenyltransferase superfamily. The designed protein sequence is
[ { "Beg": 150, "End": 395, "ID": "IPR000537", "Name": "UbiA prenyltransferase", "Type": "Family" }, { "Beg": 112, "End": 301, "ID": "IPR044878", "Name": "UbiA prenyltransferase superfamily", "Type": "Homologous_superfamily" } ]
MLQMHSNSSFSPKCYYPLQHAGCVKTLQLPLTKVHGGLNRSESKNYAIKCTQSDSFYSTNKIRNNENSSSRNCKPFNKYRVAVTLQQQDCASNNEDDINSTSFRDVLLKKLHALYVFTRPFAMIGTIVGITSIAILPLQSFADLTPKYFMEFLKALLSAVLMNNYVGTVNQVADVEIDKVNKPGLPLASGDLSVGTGLAITLILSLTSLAIALSLQSPPLIFGLIVWFLLGTAYSVDLPFLRWKTNPFLAGMCMVIVFGLVYQFSFFIHFQKYVLGRPVVITRPLIFAAAIISTISAVMSLLKDIPDEDGDKQFGYQSIS...
Generate a protein sequence for a novel protein that integrates the following function keywords: UbiA prenyltransferase, UbiA prenyltransferase superfamily. The designed protein sequence is
[ { "Beg": 150, "End": 395, "ID": "IPR000537", "Name": "UbiA prenyltransferase", "Type": "Family" }, { "Beg": 112, "End": 300, "ID": "IPR044878", "Name": "UbiA prenyltransferase superfamily", "Type": "Homologous_superfamily" } ]
MLQMHSNSSFSPKCYYPLQHAGCVKTLQLPLTKVHGGLNRSESKNYAIKCTQSDSFYSTNKIRNNENSSSRNCKPFNKYRVAVTLQQQDCASNNEDDINSTSFRDVLLKKLHALYVFTRPFAMIGTIVGITSIAILPLQSFADLTPKYFMEFLKALLSAVLMNNYVGTVNQVADVEIDKVNKPGLPLASGDLSVGTGLAITLILSLTSLAIALSLQSPPLIFGLIVWFLLGTAYSVDLPFLRWKTNPFLAGMCMVIVFGLVYQFSFFIHFQKYVLGRPVVITRPLIFAAAIISTISAVMSLLKDIPDEDGDKQFGYQSIS...
Generate a protein sequence for a novel protein that integrates the following function keywords: Six-hairpin glycosidase-like superfamily, N-acylglucosamine 2-epimerase/Cellobiose 2-epimerase, Six-hairpin glycosidase superfamily. The designed protein sequence is
[ { "Beg": 3, "End": 404, "ID": "IPR008928", "Name": "Six-hairpin glycosidase superfamily", "Type": "Homologous_superfamily" }, { "Beg": 34, "End": 387, "ID": "IPR010819", "Name": "N-acylglucosamine 2-epimerase/Cellobiose 2-epimerase", "Type": "Family" }, { "Beg": 2...
MTLWTARAAHRAWLDAEARRLVDFAAAADHPEHGFAWLDGSGAPLPEQGVHTWITCRVTHVAALAHLEGIPGASALADHGLRALAGPLRDPEHDGWFTALDSRGTVADSRKEAYQHAFVLLAAASATVAGRPGARELLDAAAAVIEQRFWEEETGRCRESWDAAWHADEPYRGANSNMHLVEAFLAAFDATGDRVWAERALRIAHFFVHEVAAPRDWRLPEHFTPDWQVVADYNTDDRAHPFRPYGVTVGHVLEWARLLVHVEAALPDPPSWLLADAEAMFAAAVARGWSVDGTEGFVYTLDYDDTPVVRSRMHWVVAEA...
Generate a protein sequence for a novel protein that integrates the following function keywords: 3'5'-cyclic nucleotide phosphodiesterase, catalytic domain superfamily, 3'5'-cyclic nucleotide phosphodiesterase, conserved site, 3'5'-cyclic nucleotide phosphodiesterase, catalytic domain, HD/PDEase domain, 3'5'-cyclic nuc...
[ { "Beg": 503, "End": 727, "ID": "IPR002073", "Name": "3'5'-cyclic nucleotide phosphodiesterase, catalytic domain", "Type": "Domain" }, { "Beg": 423, "End": 751, "ID": "IPR002073", "Name": "3'5'-cyclic nucleotide phosphodiesterase, catalytic domain", "Type": "Domain" }, ...
MKHMFKNILFHKKGKHDKNDAIKKAFSLFSVPSNENERIIKFWPLKFKEKDEETLYIIKLCDNMYSKKYVILVSHLISLLLMYSVCLIVGNINDLFSVLKLTYILLHTFTAINIILILTLHATHYVEMFKSIKGEIFIFYIMMIFVIWCSWLFILFNNIKDLLPIVVNVNNFLYATYANNKINIVLGFFAYLPIFYLITIIPCRICYSCAFDILFFIMKVAIFSVYYLITMKSYILTDNIFMIISALVGSLFIFVIRYIIEIQRRLSFHNWNKQTKQIIKLKKTLKEEKQKLSTTNIEEIYNLINDSIGNYYNENKKQKE...
Generate a protein sequence for a novel protein that integrates the following function keywords: Winged helix-like DNA-binding domain superfamily, Winged helix DNA-binding domain superfamily, Forkhead box domain-containing protein, Fork head domain, Fork head domain conserved site 2. The designed protein sequence is
[ { "Beg": 118, "End": 180, "ID": "IPR001766", "Name": "Fork head domain", "Type": "Domain" }, { "Beg": 118, "End": 131, "ID": "IPR001766", "Name": "Fork head domain", "Type": "Domain" }, { "Beg": 139, "End": 156, "ID": "IPR001766", "Name": "Fork head do...
MQSNDENIYFPANQYVNAGQYSPLQQSFSQNSQYDLFDGFAEFGFLEQVPTTNMHSFSQSTQMEQNCLPNVNNSTRKRKAPGQNEQATVKRRQIGIEKWRLPSRSVVQPSADISDLRRPPISYVALCALACRNAPDMKITPAGVYAFILHHWRYYRYANENWKNSVRHQLSSKEHFDEETFQPDPSNQTVRRKFYIVKNPNMIRQNLISDADFDFFRKDSRGIEFYQKMFAGQIGLPRSLFYQIIGNEIPFLAGPENSSMFYQLLGMGKVVGYLETRYFREHYRSEHAATEPKYEEDYANFTEKIPSNAENLMSYGAATE...
Generate a protein sequence for a novel protein that integrates the following function keywords: Periplasmic binding protein-like I, Adenylyl cyclase class-3/4/guanylyl cyclase, Cyclic nucleotide synthase, Protein kinase domain, Serine-threonine/tyrosine-protein kinase, catalytic domain, Nucleotide cyclase, Receptor, l...
[ { "Beg": 464, "End": 749, "ID": "IPR000719", "Name": "Protein kinase domain", "Type": "Domain" }, { "Beg": 474, "End": 750, "ID": "IPR000719", "Name": "Protein kinase domain", "Type": "Domain" }, { "Beg": 813, "End": 998, "ID": "IPR001054", "Name": "Ad...
MLLLLLLLKISTFVDSFQIGHLEFENSNETRILEICMKNAGSWRDHRLISLPSCHNFNGLENAANLNYQYSVDLLIGAACDEETQTVSRLALRWHKLYLSSAPLSTKEKESTTIALKPHSLAGTAEVILAMCKSMKWKEIGIIYSEETKYTAHAIYDMLAEQEDDLKINVFLETDGLSNTYTILHSARALISFLTTLDLSKFFKTLKENAFRPLEFSIVHVDCNKSEISNFYTYLDNNAGEEPNPISAARLRKLYRHVALLKNSHDDMEKTEEFAKKYGLVPSYTLYKALILCDGLQLLNNYTAPRGNLSIVQQLPYLWN...