Instruction stringlengths 135 4.21k | Keywords listlengths 1 1.73k | Sequence stringlengths 8 35.2k |
|---|---|---|
Generate a protein sequence for a novel protein that integrates the following function keywords: Phytocyanin domain, Phytocyanin-like, Cupredoxin. The designed protein sequence is | [
{
"Beg": 35,
"End": 114,
"ID": "IPR003245",
"Name": "Phytocyanin domain",
"Type": "Domain"
},
{
"Beg": 25,
"End": 125,
"ID": "IPR003245",
"Name": "Phytocyanin domain",
"Type": "Domain"
},
{
"Beg": 22,
"End": 126,
"ID": "IPR008972",
"Name": "Cupredoxin"... | MASSRVVLILSISMVLLSSVAIAATDYIVGDDKGWTVDFDYTQWAQDKVFRVGDNLVFNYDPSRHNVFKVNGTLFQSCTFPPKNEALSTGKDIIQLKTEGRKWYVCGVADHCSARQMKLVITVLAEGAPAPSPPPSSDAHSVVSSLFGVVMAIMVAIAVIFA |
Generate a protein sequence for a novel protein that integrates the following function keywords: Leghaemoglobin, iron-binding site, Leghaemoglobin-like, Globin, Globin-like superfamily, Globin/Protoglobin. The designed protein sequence is | [
{
"Beg": 39,
"End": 157,
"ID": "IPR000971",
"Name": "Globin",
"Type": "Domain"
},
{
"Beg": 210,
"End": 328,
"ID": "IPR000971",
"Name": "Globin",
"Type": "Domain"
},
{
"Beg": 12,
"End": 162,
"ID": "IPR000971",
"Name": "Globin",
"Type": "Domain"
},... | MEENKKTVDGSVDFTEEQEALVVKSWNAMKNNSCDLSLKFFTKILEIAPPAKQMFSFLKDSNVPLEQNPKLKPHAMSVFLMTCESAVQLRKAGKVRVRESNLKKLGATHFKTGVQDEHFEVTKQALLETIEEAIPEMWSLAMKNAWAEAHDQLANAIKVEMKEAHDQMDNANLIINMEENTGSCFTEEQEALVVKSWNAIKYNSGDLSLKFFKKILEIAPPAKQLFSFLKDSNVPLEHNPKLKPHAMSVFLMTCESAVQLRKAGKVTVRESNLKKLGATHFKTGVKDEHFEVTKQALLETIKEALPEMWSPAMENAWGEA... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycosyl hydrolase family 18, active site, Glycoside hydrolase superfamily, Glycoside hydrolase family 18, catalytic domain, Chitinase insertion domain superfamily, Chitinase II/V-like, catalytic domain, Glycosyl Hydrolase ... | [
{
"Beg": 48,
"End": 362,
"ID": "IPR001223",
"Name": "Glycoside hydrolase family 18, catalytic domain",
"Type": "Domain"
},
{
"Beg": 34,
"End": 379,
"ID": "IPR001223",
"Name": "Glycoside hydrolase family 18, catalytic domain",
"Type": "Domain"
},
{
"Beg": 139,
... | MANILNLKHLLTLALILLALATKSSTSSSSSITRVKGIYWLENPFFPPTTVDTSLFTHIFYSFLTPNNITYKLEISSSQILSLNTFTKTFKTKSPPAATLFSIGGAGSNSSLLAFIASDPPACAAFINSTIDVARTFGFDGIDLDWEFPKNTKEMNDLGEMLFQWRKAISDEGATTGRPPLLLTAAVYFAVNFSIYGEPRMYPVNSINENLDWVNVMSYELRGPRSNKTGAPSGTFDPKSNVSVVSGLLSWIHSGVVPEKLVMGMPLYGKSWKLRDPNVHGIGAPSVGSGPGVNGLMAYFQVLDFNRQKSAKVEYDVDTA... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Peptidase C1A, Cysteine peptidase, histidine active site, Peptidase C1A, papain C-terminal, Cathepsin propeptide inhibitor domain (I29), Cysteine peptidase, cysteine active site, Papain-like cysteine endopeptidase, Cysteine... | [
{
"Beg": 151,
"End": 162,
"ID": "IPR000169",
"Name": "Cysteine peptidase, cysteine active site",
"Type": "Active_site"
},
{
"Beg": 133,
"End": 348,
"ID": "IPR000668",
"Name": "Peptidase C1A, papain C-terminal",
"Type": "Domain"
},
{
"Beg": 151,
"End": 166,
... | MAQWTLLIVFFCVATAAAGLSFHDSNPIRMVSDMEEQLLQVIGESRHAVSFARFANRYGKRYDTVDEMKRRFKIFSENLQLIKSTNKKRLGYTLGVNHFADWTWEEFRSHRLGAAQNCSATLKGNHRITDVVLPAEKDWRKEGIVSEVKDQGHCGSCWTFSTTGALESAYAQAFGKNISLSEQQLVDCAGAYNNFGCNGGLPSQAFEYIKYNGGLETEEAYPYTGQNGLCKFTSENVAVQVLGSVNITLGAEDELKHAVAFARPVSVAFQVVDDFRLYKKGVYTSTTCGSTPMDVNHAVLAVGYGIEDGVPYWLIKNSWG... |
Generate a protein sequence for a novel protein that integrates the following function keywords: CLAVATA3/ESR (CLE)-related protein 1-4. The designed protein sequence is | [
{
"Beg": 1,
"End": 75,
"ID": "IPR039616",
"Name": "CLAVATA3/ESR (CLE)-related protein 1-4",
"Type": "Family"
}
] | MASWRMLCFVLLFTSILICHDARPLPSSLSSSNGSPAFVESVKQVVKEIMRRKQLLGTQYSTNRLSPSGPDPHHH |
Generate a protein sequence for a novel protein that integrates the following function keywords: NAD-dependent epimerase/dehydratase, NAD(P)-dependent dehydratase-like, NAD(P)-binding domain superfamily. The designed protein sequence is | [
{
"Beg": 20,
"End": 252,
"ID": "IPR001509",
"Name": "NAD-dependent epimerase/dehydratase",
"Type": "Domain"
},
{
"Beg": 14,
"End": 323,
"ID": "IPR036291",
"Name": "NAD(P)-binding domain superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 19,
"End": 316,... | MPAATAAAAAESSSVSGETICVTGAGGFIASWMVKLLLEKGYTVRGTLRNPDDPKNGHLKKLEGAKERLTLVKVDLLDLNSVKEAVNGCHGVFHTASPVTDNPEEMVEPAVNGAKNVIIAGAEAKVRRVVFTSSIGAVYMDPNRSVDVEVDESCWSDLEFCKKTKNWYCYGKAVAEAAAWDVAKEKGVDLVVVNPVLVLGPLLQPTINASTIHILKYLTGSAKTYANATQAYVHVRDVALAHILVYEKPSASGRYLCAETSLHRGELVEILAKYFPEYPIPTKCSDEKNPRVKPHIFSNKKLKDLGLEFTPVSECLYETV... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycosyl hydrolase family 18, active site, Glycoside hydrolase superfamily, Glycoside hydrolase family 18, catalytic domain, Chitinase insertion domain superfamily, Chitinase II/V-like, catalytic domain, Glycosyl Hydrolase ... | [
{
"Beg": 55,
"End": 369,
"ID": "IPR001223",
"Name": "Glycoside hydrolase family 18, catalytic domain",
"Type": "Domain"
},
{
"Beg": 39,
"End": 384,
"ID": "IPR001223",
"Name": "Glycoside hydrolase family 18, catalytic domain",
"Type": "Domain"
},
{
"Beg": 144,
... | MAVQKIIITPILVFLVTIFFNVSSSSSSNNSQYQFLNHGVRSAYWPAGDDFSPSLIDTNYFTHILLAFIQPEPISFKLEITKSGIKWGQNFIKALRHRSPPVKTLLSIGGGGSNSTLFSEIASTKQNREIFINSTIEVARKYRFDGVDLDWEFPETQQDMFNLGLLYEEWYNALFAEAKVRRKPRLLLTSAVYYNSTVRLIGKHGPRSYPTQAINKYLDWASPMCFDYHGTWDNNTDFNAALYDSKSEISTNFGLHSWIKSGVRPEKLVMGLALYGRAWELKDPNVNGVGAEAVGPATDTDGSMNYNEILKFNKQSGANV... |
Generate a protein sequence for a novel protein that integrates the following function keywords: SGNH hydrolase superfamily, GDSL lipase/esterase, GDSL lipase/esterase-like, plant. The designed protein sequence is | [
{
"Beg": 40,
"End": 365,
"ID": "IPR001087",
"Name": "GDSL lipase/esterase",
"Type": "Family"
},
{
"Beg": 38,
"End": 368,
"ID": "IPR035669",
"Name": "GDSL lipase/esterase-like, plant",
"Type": "Family"
},
{
"Beg": 30,
"End": 370,
"ID": "IPR036514",
"Nam... | MKFMAKIELSRHIPLVTLIVLVLCITPPIFATKNCDFPAIFSFGASNVDTGGLAAAFRAPPSPYGETYFHRSTGRFSDGRIILDFIARSFRLPYLSPYLNSLGSNFTHGANFASGGSTINIPKSILPNGKLSPFSLQIQYIQFKEFISKTKLIRDQGGVFATLIPKEDYFSKALYIFDIGQNDLTIGFFGNKTIQQVNATVPDIVNNYIENIKNIYNLGARSFWIHGTGPKGCAPVILANFPSAIKDSYGCAKQYNEVSQYFNFKLKEALAELRSNLSSAAITYVDIYTPKYSLFTNPEKYGFELPFVACCGYGGEYNIG... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Ammonium transporter, conserved site, Blood group Rhesus C/E/D polypeptide, Ammonium transporter AmtB-like domain, Ammonium/urea transporter, Ammonium transporter. The designed protein sequence is | [
{
"Beg": 8,
"End": 452,
"ID": "IPR001905",
"Name": "Ammonium transporter",
"Type": "Family"
},
{
"Beg": 24,
"End": 440,
"ID": "IPR001905",
"Name": "Ammonium transporter",
"Type": "Family"
},
{
"Beg": 121,
"End": 137,
"ID": "IPR002229",
"Name": "Blood g... | MSGVPFPSNLLPSPSSPEWLSKADNAWQLMAATLVGMQSVPGLIILYGGAVKKKWAVNSAFMSLYAFACVFFCWVFWAYRMSFGDTLFPFWGKPALALDEKYLFKQAFLGAFPNATMIYFQCVFAAITLILIAGAVLGRMNFYAWMMFVPLWLTFSYTFTAFSIWSTNGFLAKMGIIDYSGGYVIHLSSGVAGFTAAYWVGPRLNKDRERFPPNNLLLMLAGAGLLWMGWTGFNGGDPYSVGLDASLAVLNTHACTATSLLTWVFLDVIFFRKPSVIGAVQGMITGLVCITPAAGVVQGWAALIMGLFSGSIPWFTMMVI... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Ankyrin repeat-containing domain superfamily, Regulatory protein NPR, central domain, Regulatory protein NPR5/6, SKP1/BTB/POZ domain superfamily, BTB/POZ domain, Ankyrin repeat. The designed protein sequence is | [
{
"Beg": 18,
"End": 109,
"ID": "IPR000210",
"Name": "BTB/POZ domain",
"Type": "Domain"
},
{
"Beg": 25,
"End": 107,
"ID": "IPR000210",
"Name": "BTB/POZ domain",
"Type": "Domain"
},
{
"Beg": 25,
"End": 160,
"ID": "IPR000210",
"Name": "BTB/POZ domain",
... | MSLEETLRSLSLDYLNLLINGQAFSDVTFQVEGRLVHAHRCILAARSLFFRKFFCGPDPPSGLDPIGGGSSRQPTVRPGVIPVNSVGYEVFLLLLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAVDLALDTLAAARYFGVEQLALLTQKQLVSMVEKASIDDVMKVLIASRKQEMPQLWTTCSHLVAKSGLPPEILAKHLSIDVVAKIEELRLKSSLARRSLMPLHHHHHHHHHHDFGDLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALHYAVENCSREVVKALLELGAADVNYPAGPAGKTSLHVA... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Cyclic nucleotide-binding domain superfamily, Potassium channel, voltage-dependent, EAG/ELK/ERG-like, Cyclic nucleotide-binding domain, Ion transport domain, RmlC-like jelly roll fold. The designed protein sequence is | [
{
"Beg": 503,
"End": 561,
"ID": "IPR000595",
"Name": "Cyclic nucleotide-binding domain",
"Type": "Domain"
},
{
"Beg": 480,
"End": 565,
"ID": "IPR000595",
"Name": "Cyclic nucleotide-binding domain",
"Type": "Domain"
},
{
"Beg": 480,
"End": 611,
"ID": "IPR00... | MGFDNPRSERFEDDPEISKIPTTSGVKVKYHIDGTQIPEQSSKKSRKNETRNKFLKTRVLSRVFSEDYERVKKRVLVLDPRGQLIHRWNKIFLVACLVSLFVDPLFFYLPVVREEVCIDIGKTLEVILTVVRSFGDLFYIVQICMKFRTAYVAPSSKVFGRGELVLTYSKIALRYFSKGFWLDFIAALPLPQVLIWIIIPTLRGSTMANTKNVLRFFIIFQYIPRLYLIFPLSSQIVKATGVVTETAWAGAAYNLMLYMLASHILGACWYLLSIERQEACWKSVCNMEKSNCQYGFFNCHSIKDAPRVAWFIASNVTNLC... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Polyketide synthase, enoylreductase domain, Cinnamyl alcohol dehydrogenase-like, GroES-like superfamily, Alcohol dehydrogenase-like, C-terminal, Alcohol dehydrogenase-like, N-terminal, NAD(P)-binding domain superfamily, Alc... | [
{
"Beg": 69,
"End": 83,
"ID": "IPR002328",
"Name": "Alcohol dehydrogenase, zinc-type, conserved site",
"Type": "Conserved_site"
},
{
"Beg": 18,
"End": 182,
"ID": "IPR011032",
"Name": "GroES-like superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 192,
"... | MGSIEVAERTTVGLAAKDPSGILTPYTYTLRNTGPDDVYIKIHYCGVCHSDLHQIKNDLGMSNYPMVPGHEVVGEVLEVGSNVTRFKVGEIVGVGLLVGCCKSCRACDSEIEQYCNKKIWSYNDVYTDGKITQGGFAESTVVEQKFVVKIPEGLAPEQVAPLLCAGVTVYSPLSHFGLKTPGLRGGILGLGGVGHMGVKVAKAFGHHVTVISSSDKKKKEALEDLGADSYLVSSDTVGMQEAADSLDYIIDTVPVGHPLEPYLSLLKIDGKLILMGVINTPLQFVTPMVMLGRKSITGSFVGSVKETEEMLEFWKEKGLS... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Globin-like superfamily, Phycobilisome, alpha/beta subunit, Phycobilisome, alpha/beta subunit superfamily. The designed protein sequence is | [
{
"Beg": 1,
"End": 176,
"ID": "IPR009050",
"Name": "Globin-like superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 7,
"End": 176,
"ID": "IPR012128",
"Name": "Phycobilisome, alpha/beta subunit",
"Type": "Family"
},
{
"Beg": 1,
"End": 177,
"ID": "IPR... | MLDAFSKVITSADGKAAYVGGADLQALKKFVSDGNKRMDAVNAIVSNASCIVSDAVSGMVCENPALIAPNGGVYSNRKMAACLRDAEIILRYVSYSLLSGDSSVLEDRCLNGLKETYASLGVPAAGNARAVAIMKATVNGFINNTAQQKKLSTPAGDCSALASEAGGYFDKVSSALA |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is... | [
{
"Beg": 28,
"End": 115,
"ID": "IPR003599",
"Name": "Immunoglobulin domain subtype",
"Type": "Domain"
},
{
"Beg": 16,
"End": 116,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 26,
"End": 110,
"ID": "IPR013106",
"... | MEAPAQLLFLLLLWLPDTTREIVMTQSPPTLSLSPGERVTLSCRASQSVSSSYLTWYQQKPGQAPRLLIYGASTRATSIPARFSGSGSGTDFTLTISSLQPEDFAVYYCQQDYNLP |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 18,
"End": 117,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 28,
"End": 111,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 40,
"End": 112,
"ID": "IPR013106",
"Na... | MDMRVPAQLLGLLLLWLPGVRFDIQMTQSPSFLSASVGDRVSIICWASEGISSNLAWYLQKPGKSPKLFLYDAKDLHPGVSSRFSGRGSGTDFTLTIISLKPEDFAAYYCKQDFSYP |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is... | [
{
"Beg": 27,
"End": 119,
"ID": "IPR003599",
"Name": "Immunoglobulin domain subtype",
"Type": "Domain"
},
{
"Beg": 5,
"End": 119,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 26,
"End": 116,
"ID": "IPR013106",
"N... | MAWTPLLFLTLLLHCTGSLSQLVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQPEKGPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTWGTGI |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is... | [
{
"Beg": 31,
"End": 122,
"ID": "IPR003599",
"Name": "Immunoglobulin domain subtype",
"Type": "Domain"
},
{
"Beg": 25,
"End": 122,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 30,
"End": 116,
"ID": "IPR013106",
"... | MSVPTMAWMMLLLGLLAYGSGVDSQTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQAPRTLIYSTNTRSSGVPDRFSGSILGNKAALTITGAQADDESDYYCVLYMGSGI |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is... | [
{
"Beg": 28,
"End": 120,
"ID": "IPR003599",
"Name": "Immunoglobulin domain subtype",
"Type": "Domain"
},
{
"Beg": 23,
"End": 120,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 27,
"End": 118,
"ID": "IPR013106",
"... | MAWTPLLLLFPLLLHCTGSLSQPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWHQQQPGKAPRYLMKLEGSGSYNKGSGVPDRFSGSSSGADRYLTISNLQFEDEADYYCETWDSNT |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is... | [
{
"Beg": 26,
"End": 123,
"ID": "IPR003599",
"Name": "Immunoglobulin domain subtype",
"Type": "Domain"
},
{
"Beg": 21,
"End": 123,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 24,
"End": 120,
"ID": "IPR013106",
"... | MALTPLLLLLLSHCTGSLSRPVLTQPPSLSASPGATARLPCTLSSDLSVGGKNMFWYQQKLGSSPRLFLYHYSDSDKQLGPGVPSRVSGSKETSSNTAFLLISGLQPEDEADYYCQVYESSAN |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 2,
"End": 117,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 24,
"End": 111,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 36,
"End": 110,
"ID": "IPR013106",
"Nam... | MPWALLLLTLLTHSAVSVVQAGLTQPPSVSKGLRQTATLTCTGNSNIVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSALDSSLSA |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is... | [
{
"Beg": 26,
"End": 118,
"ID": "IPR003599",
"Name": "Immunoglobulin domain subtype",
"Type": "Domain"
},
{
"Beg": 20,
"End": 118,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 24,
"End": 114,
"ID": "IPR013106",
"... | MAWSSLLLTLLAHCTGSWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYVVHWYQQLPGTAPKLLIYGNSNRPSGVPDQFSGSKSGTSASLAITGLQSEDEADYYCKAWDNSLNA |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 5,
"End": 105,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 24,
"End": 104,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 20,
"End": 105,
"ID": "IPR013783",
"Nam... | MAWTPLLLLFLSHCTGSLSQAVLTQPTSLSASPGASARLTCTLRSGISVGSYRIYWYQQKPGSPPRYLLNYYSDSDKHQGSGVPSRFSGSKDASTNAGILFISGL |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is... | [
{
"Beg": 26,
"End": 117,
"ID": "IPR003599",
"Name": "Immunoglobulin domain subtype",
"Type": "Domain"
},
{
"Beg": 15,
"End": 117,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 25,
"End": 111,
"ID": "IPR013106",
"... | MAWTPLFLFLLTCCPGSNSQAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPYWFQQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLLGAQPEDEAEYYCLLSYSGAR |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is... | [
{
"Beg": 26,
"End": 123,
"ID": "IPR003599",
"Name": "Immunoglobulin domain subtype",
"Type": "Domain"
},
{
"Beg": 21,
"End": 123,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 24,
"End": 121,
"ID": "IPR013106",
"... | MAWTPLLLLLLSHCTGSLSQPVLTQPPSSSASPGESARLTCTLPSDINVGSYNIYWYQQKPGSPPRYLLYYYSDSDKGQGSGVPSRFSGSKDASANTGILLISGLQSEDEADYYCMIWPSNAS |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is... | [
{
"Beg": 26,
"End": 117,
"ID": "IPR003599",
"Name": "Immunoglobulin domain subtype",
"Type": "Domain"
},
{
"Beg": 34,
"End": 118,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 25,
"End": 114,
"ID": "IPR013106",
"... | MAWALLLLTLLTQGTGSWAQSALTQPPFVSGAPGQSVTISCTGTSSDVGDYDHVFWYQKRLSTTSRLLIYNVNTRPSGISDLFSGSKSGNMASLTISGLKSEVEANYHCSLYSSSYTF |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is... | [
{
"Beg": 26,
"End": 114,
"ID": "IPR003599",
"Name": "Immunoglobulin domain subtype",
"Type": "Domain"
},
{
"Beg": 9,
"End": 115,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 27,
"End": 108,
"ID": "IPR013106",
"N... | MAWATLLLPLLNLYTGSVASYELTQLPSVSVSPGQTARITCSGDVLGENYADWYQQKPGQAPELVIYEDSERYPGIPERFSGSTSGNTTTLTISRVLTEDEADYYCLSGDEDNPS |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is... | [
{
"Beg": 26,
"End": 117,
"ID": "IPR003599",
"Name": "Immunoglobulin domain subtype",
"Type": "Domain"
},
{
"Beg": 20,
"End": 118,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 24,
"End": 114,
"ID": "IPR013106",
"... | MAWALLLLTLLTQGTGSWAQSALTQPPSVSGSPGQSVTISCTGTSSDVGSYNRVSWYQQPPGTAPKLMIYEVSNRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCSLYTSSSTF |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is... | [
{
"Beg": 26,
"End": 114,
"ID": "IPR003599",
"Name": "Immunoglobulin domain subtype",
"Type": "Domain"
},
{
"Beg": 9,
"End": 115,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 24,
"End": 108,
"ID": "IPR013106",
"N... | MAWIPLLLPLLTLCTGSEASYELTQPPSVSVSLGQMARITCSGEALPKKYAYWYQQKPGQFPVLVIYKDSERPSGIPERFSGSSSGTIVTLTISGVQAEDEADYYCLSADSSGTY |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is... | [
{
"Beg": 26,
"End": 115,
"ID": "IPR003599",
"Name": "Immunoglobulin domain subtype",
"Type": "Domain"
},
{
"Beg": 5,
"End": 115,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 24,
"End": 112,
"ID": "IPR013106",
"N... | MAWTPLLLSLLAHCTGSATSYELTQPHSVSVATAQMARITCGGNNIGSKAVHWYQQKPGQDPVLVIYSDSNRPSGIPERFSGSNPGNTATLTISRIEAGDEADYYCQVWDSSSDH |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is... | [
{
"Beg": 26,
"End": 114,
"ID": "IPR003599",
"Name": "Immunoglobulin domain subtype",
"Type": "Domain"
},
{
"Beg": 9,
"End": 115,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 24,
"End": 110,
"ID": "IPR013106",
"N... | MAWTPLLLPLLTFCTVSEASYELTQPPSVSVSPGQTARITCSGDALPKKYAYWYQQKSGQAPVLVIYEDSKRPSGIPERFSGSSSGTMATLTISGAQVEDEADYYCYSTDSSGNH |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is... | [
{
"Beg": 26,
"End": 115,
"ID": "IPR003599",
"Name": "Immunoglobulin domain subtype",
"Type": "Domain"
},
{
"Beg": 34,
"End": 115,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 24,
"End": 112,
"ID": "IPR013106",
"... | MAWTALLLSLLAHFTGSVASYELTQPLSVSVALGQTARITCGGNNIGSKNVHWYQQKPGQAPVLVIYRDSNRPSGIPERFSGSNSGNTATLTISRAQAGDEADYYCQVWDSSTAH |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is... | [
{
"Beg": 26,
"End": 122,
"ID": "IPR003599",
"Name": "Immunoglobulin domain subtype",
"Type": "Domain"
},
{
"Beg": 21,
"End": 122,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 24,
"End": 112,
"ID": "IPR013106",
"... | MAWVSFYLLPFIFSTGLCALPVLTQPPSASALLGASIKLTCTLSSEHSTYTIEWYQQRPGRSPQYIMKVKSDGSHSKGDGIPDRFMGSSSGADRYLTFSNLQSDDEAEYHCGESHTIDGQVG |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin-like fold, T cell receptor gamma variable/constant region. The designed protein sequence is | [
{
"Beg": 17,
"End": 119,
"ID": "IPR013783",
"Name": "Immunoglobulin-like fold",
"Type": "Homologous_superfamily"
},
{
"Beg": 26,
"End": 117,
"ID": "IPR036179",
"Name": "Immunoglobulin-like domain superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 6,
"E... | MPLVVAVIFFSLWVFALGQLEQPEISISRPANKSAHISWKASIQGFSSKIIHWYWQKPNKGLEYLLHVFLTISAQDCSGGKTKKLEVSKNAHTSTSTLKIKFLEKEDEVVYHCACWIRH |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin-like fold, Immunoglobulin V-set domain, T cell receptor beta variable. The designed protein sequence is | [
{
"Beg": 25,
"End": 110,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 12,
"End": 115,
"ID": "IPR013783",
"Name": "Immunoglobulin-like fold",
"Type": "Homologous_superfamily"
},
{
"Beg": 23,
"End": 110,
"ID": "IPR03... | MGTRLLCWAALCLLGADHTGAGVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGAADDSGLPKDRFFAVRPEGSVSTLKIQRTEQGDSAAYLRASSL |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, T cell receptor beta variable, Immunoglobulin-like domain, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 34,
"End": 114,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 25,
"End": 111,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 37,
"End": 112,
"ID": "IPR013106",
"Na... | MSNQVLCCVVLCLLGANTVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSI |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, T cell receptor beta variable, Immunoglobulin-like domain, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 10,
"End": 111,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 21,
"End": 109,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 32,
"End": 110,
"ID": "IPR013106",
"Na... | MLLLLLLLGPGSGLGAVVSQHPSRVICKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSAR |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, T cell receptor beta variable, Immunoglobulin-like domain, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 21,
"End": 115,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 25,
"End": 111,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 37,
"End": 112,
"ID": "IPR013106",
"Na... | MASLLFFCGAFYLLGTGSMDADVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLQLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSDL |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, T cell receptor beta variable, Immunoglobulin-like domain, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 21,
"End": 114,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 25,
"End": 111,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 19,
"End": 114,
"ID": "IPR013783",
"Na... | MTIRLLCYVGFYFLGAGLMEADIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 20,
"End": 120,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 26,
"End": 114,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 38,
"End": 115,
"ID": "IPR013106",
"Na... | MRLPAQLLGLLMLWVSGSSGDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Heavy Variable, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 32,
"End": 118,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 31,
"End": 117,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 37,
"End": 118,
"ID": "IPR013106",
"Na... | MMEFGLSWVFLVAIFKGVQCEVQLVESGEGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDMAVYYCAR |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, T cell receptor gamma variable/constant region, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 14,
"End": 118,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 28,
"End": 115,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 18,
"End": 118,
"ID": "IPR013783",
"Na... | MQWALAVLLAFLSPASQKSSNLEGRTKSVIRQTGSSAEITCDLAEGSNGYIHWYLHQEGKAPQRLQYYDSYNSKVVLESGVSPGKYYTYASTRNNLRLILRNLIENDFGVYYCATWDG |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Heavy Variable, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 14,
"End": 117,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 30,
"End": 116,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 36,
"End": 117,
"ID": "IPR013106",
"Na... | MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSGTLSLTCAVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSTNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCAR |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 16,
"End": 120,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 26,
"End": 114,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 38,
"End": 115,
"ID": "IPR013106",
"Na... | MRLLAQLLGLLMLWVPGSSGDIVMTQTPLSSPVTLGQPASISFRSSQSLVHSDGNTYLSWLQQRPGQPPRLLIYKVSNRFSGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCTQATQFP |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is... | [
{
"Beg": 28,
"End": 119,
"ID": "IPR003599",
"Name": "Immunoglobulin domain subtype",
"Type": "Domain"
},
{
"Beg": 16,
"End": 120,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 26,
"End": 114,
"ID": "IPR013106",
"... | MRLPAQLLGLLMLWIPGSSADIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQPPQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIQLP |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is... | [
{
"Beg": 30,
"End": 116,
"ID": "IPR003599",
"Name": "Immunoglobulin domain subtype",
"Type": "Domain"
},
{
"Beg": 18,
"End": 117,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 28,
"End": 111,
"ID": "IPR013106",
"... | MDMRVPAQLLGLLLLWFPGARCNIQMTQSPSAMSASVGDRVTITCRARQGISNYLAWFQQKPGKVPKHLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYP |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin domain subtype, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is... | [
{
"Beg": 30,
"End": 115,
"ID": "IPR003599",
"Name": "Immunoglobulin domain subtype",
"Type": "Domain"
},
{
"Beg": 18,
"End": 117,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 28,
"End": 112,
"ID": "IPR013106",
"... | MDMRVPAQLLGLLLLWLPDTRCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYNSAP |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 16,
"End": 120,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 26,
"End": 114,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 38,
"End": 115,
"ID": "IPR013106",
"Na... | MRLPAQLLGLLMLWVPGSSGDVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNWFQQRPGQSPRRLIYKVSNWDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWP |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, Immunoglobulin Variable Light Chain, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 24,
"End": 117,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 28,
"End": 109,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 40,
"End": 112,
"ID": "IPR013106",
"Na... | MDMRVPAQLLGLLLLWVPGARCDIQLTQSPSSLSASVGDRVTITCRVSQGISSYLNWYRQKPGKVPKLLIYSASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYGQRTYNAP |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, T cell receptor variable domain, Immunoglobulin-like domain, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 23,
"End": 113,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 27,
"End": 112,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 39,
"End": 112,
"ID": "IPR013106",
"Na... | MKSLRVLLVILWLQLSWVWSQQKEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVN |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, T cell receptor variable domain, Immunoglobulin-like domain, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 41,
"End": 132,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 45,
"End": 130,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 57,
"End": 131,
"ID": "IPR013106",
"Na... | MAFWLRSLGLHFRPHLGRRMESFLGGVLLILWLQVDWVKSQKIEQNSEALNIQEGKTATLTCNYTNYSPAYLQWYRQDPGRGPVFLLLIRENEKEKRKERLKVTFDTTLKQSLFHITASQPADSATYLCALD |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, T cell receptor variable region, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 7,
"End": 112,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 25,
"End": 110,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 20,
"End": 112,
"ID": "IPR013783",
"Nam... | MNSSPGPAIALFLMFGGINGDSVVQTEGQVLPSEGDSLIVNCSYETTQYPSLFWYVQYPGEGPQLHLKAMKANDKGRNKGFEAMYRKETTSFHLEKDSVQESDSAVYFCALS |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, T cell receptor alpha variable region, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 36,
"End": 112,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 35,
"End": 111,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 39,
"End": 111,
"ID": "IPR013106",
"Na... | MEKMRRPVLIIFCLCLGWANGENQVEHSPHFLGPQQGDVASMSCTYSVSRFNNLQWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDSATYFCAVD |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, T cell receptor variable domain, Immunoglobulin-like domain, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 23,
"End": 113,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 27,
"End": 112,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 39,
"End": 112,
"ID": "IPR013106",
"Na... | MMKCPQALLAIFWLLLSWVSSEDKVVQSPLSLVVHEGDTVTLNCSYEVTNFRSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSSILDKKELFSILNITATQTGDSAIYLCAVE |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, T cell receptor variable domain, Immunoglobulin-like domain, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 30,
"End": 121,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 34,
"End": 119,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 46,
"End": 120,
"ID": "IPR013106",
"Na... | MDKILGASFLVLWLQLCWVSGQQKEKSDQQQVKQSPQSLIVQKGGISIINCAYENTAFDYFPWYQQFPGKGPALLIAIRPDVSEKKEGRFTISFNKSAKQFSSHIMDSQPGDSATYFCAAS |
Generate a protein sequence for a novel protein that integrates the following function keywords: Immunoglobulin-like domain superfamily, Immunoglobulin V-set domain, Immunoglobulin-like domain, T cell receptor variable region, Immunoglobulin-like fold. The designed protein sequence is | [
{
"Beg": 21,
"End": 111,
"ID": "IPR007110",
"Name": "Immunoglobulin-like domain",
"Type": "Domain"
},
{
"Beg": 25,
"End": 109,
"ID": "IPR013106",
"Name": "Immunoglobulin V-set domain",
"Type": "Domain"
},
{
"Beg": 37,
"End": 110,
"ID": "IPR013106",
"Na... | MLSASCSGLVILLIFRRTSGDSVTQTEGPVTLPERAALTLNCTYQSSYSTFLFWYVQYLNKEPELLLKSSENQETDSRGFQASPIKSDSSFHLEKPSVQLSDSAVYYCALR |
Generate a protein sequence for a novel protein that integrates the following function keywords: Major Intrinsic Protein/Aquaporin, Major intrinsic protein, Aquaporin-like. The designed protein sequence is | [
{
"Beg": 35,
"End": 276,
"ID": "IPR000425",
"Name": "Major intrinsic protein",
"Type": "Family"
},
{
"Beg": 39,
"End": 58,
"ID": "IPR000425",
"Name": "Major intrinsic protein",
"Type": "Family"
},
{
"Beg": 78,
"End": 102,
"ID": "IPR000425",
"Name": "Ma... | MVQASGHRRSTRGSKMVSWSVIAKIQEIWCEEDERKMVREFLAEFMSTYVMMVFGLGSVAHMVLNKTYGSYLGVNLGFGFGVTMGVHVAGRISGAHMNAAVTFTNCALGRVPWRKFPVHVLGQFLGSFLAAATIYSLFYTAILHFSGGELMVTGPFATAGIFATYLPDHMTLWRGFLNEEWLTRMLQLCLFTITDQENNPALPGTHALVISILVVIIRVSHGINTGYAINPSRDPPPSIFTFIAGWGKQVFSDGENWWWVPVVAPLLGASLGGIIYLVFIGSTIPREPLKLEDSVAYEDHGITVLPKMGSHEPMISPLTL... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Cyclophilin-like domain superfamily, Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain, Cyclophilin-type peptidyl-prolyl cis-trans isomerase, conserved site, Cyclophilin-type peptidyl-prolyl cis-trans isomerase. T... | [
{
"Beg": 9,
"End": 162,
"ID": "IPR002130",
"Name": "Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain",
"Type": "Domain"
},
{
"Beg": 24,
"End": 39,
"ID": "IPR002130",
"Name": "Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain",
"Type": "Domain"
},
... | MVNSVVFFEITRDGKPLGRISIKLFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTRPNGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICAAKTEWLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKITIADCGQF |
Generate a protein sequence for a novel protein that integrates the following function keywords: Cyclophilin-like domain superfamily, Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain, Cyclophilin-type peptidyl-prolyl cis-trans isomerase, conserved site, Cyclophilin-type peptidyl-prolyl cis-trans isomerase. T... | [
{
"Beg": 7,
"End": 162,
"ID": "IPR002130",
"Name": "Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain",
"Type": "Domain"
},
{
"Beg": 24,
"End": 39,
"ID": "IPR002130",
"Name": "Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain",
"Type": "Domain"
},
... | MVNSVVFFDITVDGKPLGRISIKLFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTRPNGTDDKSIYGEKFDDENLIRKHTGSGILSMVNAGPNTNGSQLFICTAKTEWLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKITIADCGQF |
Generate a protein sequence for a novel protein that integrates the following function keywords: Flavin Monoamine Oxidase, Flavin amine oxidase, Amine oxidase, FAD/NAD(P)-binding domain superfamily. The designed protein sequence is | [
{
"Beg": 7,
"End": 26,
"ID": "IPR001613",
"Name": "Flavin amine oxidase",
"Type": "Family"
},
{
"Beg": 411,
"End": 428,
"ID": "IPR001613",
"Name": "Flavin amine oxidase",
"Type": "Family"
},
{
"Beg": 15,
"End": 429,
"ID": "IPR002937",
"Name": "Amine ox... | MTEKIYDAIVVGAGFSGLVAARELSAQGRSVLIIEARHRLGGRTHVVNFLGRPVEIGGAGVHWCQPHVFAEMQRYGFGFKEAPLADLDKAYMVFADGQKIDVPPATFDEEYTTAFEKFCSRSRELFPRPYSPLDNHEVSNLDGVSARDHLESLGLNELQLASMNAELTLYGGAPTTELSYPSFVKFHALASWDTITFTDSEKRYHVQGGTNALCQAIFDDCRADSEFGVPVEAVAQTDNGVTVTLADKRVFRALTCVLTLPTKVYADVRFEPPLPPEKRAFIEHAEMADGAELYVHVRQNLGNTFTFCDDPNPFNAVQTY... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Methyltransferase type 11, S-adenosyl-L-methionine-dependent methyltransferase superfamily, Erg6/SMT methyltransferase, SAM-dependent methyltransferase gTMT-type. The designed protein sequence is | [
{
"Beg": 72,
"End": 169,
"ID": "IPR013216",
"Name": "Methyltransferase type 11",
"Type": "Domain"
},
{
"Beg": 1,
"End": 290,
"ID": "IPR025774",
"Name": "SAM-dependent methyltransferase gTMT-type",
"Type": "Family"
},
{
"Beg": 10,
"End": 288,
"ID": "IPR0290... | MAEKQQAVAEFYDNSTGAWEVFFGDHLHDGFYDPGTTATIAGSRAAVVRMIDEALRFANISDDPAKKPKTMLDVGCGIGGTCLHVAKKYGIQCKGITISSEQVKCAQGFAEEQGLEKKVSFDVGDALDMPYKDGTFDLVFTIQCIEHIQDKEKFIREMVRVAAPGAPIVIVSYAHRNLSPSEGSLKPEEKKVLKKICDNIVLSWVCSSADYVRWLTPLPVEDIKAADWTQNITPFYPLLMKEAFTWKGFTSLLMKGGWSAIKVVLAVRMMAKAADDGVLKFVAVTCRKSK |
Generate a protein sequence for a novel protein that integrates the following function keywords: Methyltransferase type 11, S-adenosyl-L-methionine-dependent methyltransferase superfamily, Erg6/SMT methyltransferase, SAM-dependent methyltransferase gTMT-type. The designed protein sequence is | [
{
"Beg": 104,
"End": 201,
"ID": "IPR013216",
"Name": "Methyltransferase type 11",
"Type": "Domain"
},
{
"Beg": 24,
"End": 322,
"ID": "IPR025774",
"Name": "SAM-dependent methyltransferase gTMT-type",
"Type": "Family"
},
{
"Beg": 15,
"End": 289,
"ID": "IPR02... | MYTCSIIIYILTFWQLSKIKKQVAAAEKQVMTVTEKQEAVAEFYDKSTDAWEVFFGEHLHDGFYEPGTTATIPGSKVAVVRMIDELLRFAGISDDPEKKPKTMLDVGCGLGGTCLHVAKKYDIKCTGITISPEQVKCAQDLAATQGLESKVSFDVGDALDMPYKDGTFDLVFTIQCIEHIQDKEKFIREMVRVAAPGAPVVIAGYAARNLSPSEESLKPEEKMVLEKICDHIVLSWLCSTGDYVKWLTPLPVQDIKVWDLTQNITPFYPLCIKEAFTWKSFTSLLKMGGWSAIKVVFAVKMMAMAAEEGLLKFAAVTCRK... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Aldolase-type TIM barrel, Transaldolase, active site, Transaldolase/Fructose-6-phosphate aldolase, Transaldolase type 1. The designed protein sequence is | [
{
"Beg": 15,
"End": 315,
"ID": "IPR001585",
"Name": "Transaldolase/Fructose-6-phosphate aldolase",
"Type": "Family"
},
{
"Beg": 2,
"End": 321,
"ID": "IPR001585",
"Name": "Transaldolase/Fructose-6-phosphate aldolase",
"Type": "Family"
},
{
"Beg": 4,
"End": 322,... | MSSSLEQLKATGTTVVSDSGDFVSIGKYKPQDATTNPSLILAASKKAEYAKLIDVAIDYAKQKGGSIDQQVDDALDRLLVEFGKEILKIIPGKVSTEVDARYSFDTEASVNKALHLIELYGEQGISKDRILIKIAATWEGIKAAEILQRDHGINTNLTLMFSLVQAIGAAEAGAYLISPFVGRILDWFKASTKKEYSKEEDPGVQSVKTIFNYYKKYGYNTIVMGASFRNTGEITELAGCDYLTISPNLLEDLLNSNEPVPKKLDASQAASLDIEKKSYINDEALFRFDFNEDQMAVEKLREGISKFAADAVTLKSILKE... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Bulb-type lectin domain, Serine/threonine-protein kinase, active site, Protein kinase-like domain superfamily, S-receptor-like serine/threonine-protein kinase, Bulb-type lectin domain superfamily, G-type lectin S-receptor-l... | [
{
"Beg": 526,
"End": 791,
"ID": "IPR000719",
"Name": "Protein kinase domain",
"Type": "Domain"
},
{
"Beg": 523,
"End": 797,
"ID": "IPR000719",
"Name": "Protein kinase domain",
"Type": "Domain"
},
{
"Beg": 523,
"End": 797,
"ID": "IPR000719",
"Name": "Pr... | MVALLLFPMLLQLLSPTCAQTQKNITLGSTLAPQGPASSWLSPSGDFAFGFRPVEGNTSFYLIAVWFNKISDKTVVWYAKNTDQDPSIVEVPSDSFLQLTNDGALSLKDRSGQEGWNPQVTGVAYASMRDTGNFVLLGADGTTKWQTFDMPSDTILPTQVIPCNKTRNKSLRARLDIDDYSSGRFLLDVQTDGNLALYLVAVPSGSKYQQYWSTDTTGNGSELVFSETGKVYFALTDGTQINISSDAGIGSMADYFHRATLDPDGVFRQYVYPKKANAGILGGETWTALSMQPQNICHAIVSDVGSGVCGFNSYCTFDGT... |
Generate a protein sequence for a novel protein that integrates the following function keywords: C2 domain superfamily, Synaptotagmin, C2 domain. The designed protein sequence is | [
{
"Beg": 157,
"End": 262,
"ID": "IPR000008",
"Name": "C2 domain",
"Type": "Domain"
},
{
"Beg": 287,
"End": 392,
"ID": "IPR000008",
"Name": "C2 domain",
"Type": "Domain"
},
{
"Beg": 173,
"End": 185,
"ID": "IPR000008",
"Name": "C2 domain",
"Type": "D... | MVSESHHEALAAPPATTVAAAPPSNVTEPASPGGGGGKEDAFSKLKEKFMNELNKIPLPPWALIAIAIVAVLLILTCCFCLCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQDDDAETGLTDGEEKEEPKEVEKLGKIQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEYKVAMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNG... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Terpene synthase-like, Isoprenoid synthase domain superfamily, Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid, Terpene synthase, N-terminal domain superfamily, Terpene synthase, N-terminal domain. The desig... | [
{
"Beg": 273,
"End": 481,
"ID": "IPR001906",
"Name": "Terpene synthase, N-terminal domain",
"Type": "Domain"
},
{
"Beg": 113,
"End": 299,
"ID": "IPR008930",
"Name": "Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid",
"Type": "Homologous_superfamily"
},
... | MSMTLFASVTRPGLPGPTALRFPETRHLFHSVTAFAASFSPSKSSVGSSQCNATTPPAEYKEYTGNDLAKTTVDGIEKDIHSNKGLSDKTRELVMSIRSILRTMEEGEISMSPYDTAWVAMVEDIDGGGGPHFPSTLDWISSNQLADGSWGDPIFLVYDRLINTFACVIALTSWKMHPDKCDKAISFIRENMYKLDDEKEERMPIGFEMTFPPLVEKAKRLNINFPDDSPGLRKIYAQRDLKFKRIPWDKMHTVPTTLLYSLEGMALEADVLDWQKLLKLQSPDGSLFYSPASTAFALQQTGDHNCLQYLLKLVQTFNGG... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Terpene synthase-like, Isoprenoid synthase domain superfamily, Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid, Terpene synthase, N-terminal domain superfamily, Terpene synthase, N-terminal domain. The desig... | [
{
"Beg": 265,
"End": 469,
"ID": "IPR001906",
"Name": "Terpene synthase, N-terminal domain",
"Type": "Domain"
},
{
"Beg": 84,
"End": 389,
"ID": "IPR008930",
"Name": "Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid",
"Type": "Homologous_superfamily"
},
{... | MGSLSTLNLIKTCVTLASSEKLNQPSQCYTISTCMKSSNNPPFNYYQINGRKKMSTAIDSSVNAPPEQKYNSTALEHDTEIIEIEDHIECIRRLLRTAGDGRISVSPYDTAWIALIKDLDGHDSPQFPSSMEWVADNQLPDGSWGDEHFVCVYDRLVNTIACVVALRSWNVHAHKCEKGIKYIKENVHKLEDANEEHMTCGFEVVFPALLQRAQSMGIKGIPYNAPVIEEIYNSREKKLKRIPMEVVHKVATSLLFSLEGLENLEWEKLLKLQSPDGSFLTSPSSTAFAFIHTKDRKCFNFINNIVHTFKGGAPHTYPVD... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Terpene synthase-like, Isoprenoid synthase domain superfamily, Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid, Terpene synthase, N-terminal domain superfamily, Terpene synthase, N-terminal domain. The desig... | [
{
"Beg": 266,
"End": 455,
"ID": "IPR001906",
"Name": "Terpene synthase, N-terminal domain",
"Type": "Domain"
},
{
"Beg": 107,
"End": 188,
"ID": "IPR008930",
"Name": "Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid",
"Type": "Homologous_superfamily"
},
... | MASTPTLNLSITTPFVRTKIPAKISLPACSWLDRSSSRHVELNHKFCRKLELKVAMCRASLDVQQVRDEVYSNAQPHELVDKKIEERVKYVKNLLSTMDDGRINWSAYDTAWISLIKDFEGRDCPQFPSTLERIAENQLPDGSWGDKDFDCSYDRIINTLACVVALTTWNVHPEINQKGIRYLKENMRKLEETPTVLMTCAFEVVFPALLKKARNLGIHDLPYDMPIVKEICKIGDEKLARIPKKMMEKETTSLMYAAEGVENLDWERLLKLRTPENGSFLSSPAATVVAFMHTKDEDCLRYIKYLLNKFNGGAPNVYPV... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Terpene synthase-like, Isoprenoid synthase domain superfamily, Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid, Terpene synthase, N-terminal domain superfamily, Terpene synthase, N-terminal domain, Terpene s... | [
{
"Beg": 46,
"End": 208,
"ID": "IPR001906",
"Name": "Terpene synthase, N-terminal domain",
"Type": "Domain"
},
{
"Beg": 275,
"End": 514,
"ID": "IPR005630",
"Name": "Terpene synthase, metal-binding domain",
"Type": "Domain"
},
{
"Beg": 62,
"End": 230,
"ID":... | MSITFNLKIAPFSGPGIQRSKETFPATEIQITASTKSTMTTKCSFNASTDFMGKLREKVGGKADKPPVVIHPVDISSNLCMIDTLQSLGVDRYFQSEINTLLEHTYRLWKEKKKNIIFKDVSCCAIAFRLLREKGYQVSSDKLAPFADYRIRDVATILELYRASQARLYEDEHTLEKLHDWSSNLLKQHLLNGSIPDHKLHKQVEYFLKNYHGILDRVAVRRSLDLYNINHHHRIPDVADGFPKEDFLEYSMQDFNICQAQQQEELHQLQRWYADCRLDTLNYGRDVVRIANFLTSAIFGEPEFSDARLAFAKHIILVTR... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Terpene synthase-like, Isoprenoid synthase domain superfamily, Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid, Terpene synthase, N-terminal domain superfamily, Terpene synthase, N-terminal domain, Terpene c... | [
{
"Beg": 203,
"End": 389,
"ID": "IPR001906",
"Name": "Terpene synthase, N-terminal domain",
"Type": "Domain"
},
{
"Beg": 462,
"End": 697,
"ID": "IPR005630",
"Name": "Terpene synthase, metal-binding domain",
"Type": "Domain"
},
{
"Beg": 47,
"End": 235,
"ID"... | IDESQTSLDTGVQRFTSSKIASSVQCFEDTKARIVKLIHKPELSVSTYDTAWVAMVPSPNSSNEPCFPDCLAWLLENQCCDGSWACPHHHPFLKKDVLSSTLACILALKKWGVGEEQINKGARFIEVNFASATEKSQISPTGFDIIFPAMLDYARDLFLDLRLEPTTFDNLIFRRDLELKRCYESHREAYLAYIAEGMGKLQDWESVMKYQRKNGSLFNSPSTTAAAFIALPNSGCLSYLHSALKKFGNAVPAAYPLDVYSRLRTVDNLESLGISRYFQKEIQQVLDETYRWWLQGSEEIFLDASTCALAFRTLRMNGYN... |
Generate a protein sequence for a novel protein that integrates the following function keywords: L-gulonolactone/D-arabinono-1,4-lactone oxidase-like, FAD linked oxidase, N-terminal, D-arabinono-1,4-lactone oxidase, C-terminal domain, FAD-binding, type PCMH-like superfamily, Vanillyl-alcohol oxidase, C-terminal subdoma... | [
{
"Beg": 18,
"End": 141,
"ID": "IPR006094",
"Name": "FAD linked oxidase, N-terminal",
"Type": "Domain"
},
{
"Beg": 233,
"End": 466,
"ID": "IPR007173",
"Name": "D-arabinono-1,4-lactone oxidase, C-terminal domain",
"Type": "Domain"
},
{
"Beg": 1,
"End": 334,
... | MAQGAQRKNFGHNQILRPSAAYTPVDEQEVLQILDRHRGQRIRAVGRLHSWSEAVTGDGVLLDLQRLNDVRLQSDGDQLVATVGAGCQIKRLLKELNREGATLHSLGLITAQTIAGAISTGTHGSGRNSMSHYVVGVRLACYDASTGQAIIEELSAGEPLQAARCSLGSLGIILAVRIRCREQYNVQEHFTESRRLLDVMDAEAPFPLQQFYLLPWRWSYFIQHRREDDRPRSRLARLYRLYWLGTMDYGLILQILFLERVARSRRLIRLAFRRIIPAFLIRNWRVTDRSSSMLVMRHDAFRHIEIELFVRRDQLADALG... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Translation Initiation factor eIF- 4e-like, Eukaryotic translation initiation factor 4E (eIF-4E), conserved site, Translation Initiation factor eIF- 4e. The designed protein sequence is | [
{
"Beg": 48,
"End": 200,
"ID": "IPR001040",
"Name": "Translation Initiation factor eIF- 4e",
"Type": "Family"
},
{
"Beg": 14,
"End": 210,
"ID": "IPR001040",
"Name": "Translation Initiation factor eIF- 4e",
"Type": "Family"
},
{
"Beg": 103,
"End": 126,
"ID"... | MVDEVEKPASLEESKTNTREVEEGAEEVIESDDTMSSLGNPCKAMKHPLEHSWTFWFDNPSGKSKQAAWGSSIRPIYTFSTVEDFWSVYNNIHHPSKLAVGADFHCFKNKIEPKWEDPVCASGGKWTMSFSRGKSDTCWLYTLLAMIGEQFDCGDEICGAVINVRVRQEKIALWTRNAANETAQVSIGKQWKEFLDYNDSIGFIFHDDAKKLDRAAKNRYSV |
Generate a protein sequence for a novel protein that integrates the following function keywords: Metal-dependent hydrolase, composite domain superfamily, Metallo-dependent Hydrolase Enzymes, Amidohydrolase-related, Metal-dependent hydrolase. The designed protein sequence is | [
{
"Beg": 102,
"End": 462,
"ID": "IPR006680",
"Name": "Amidohydrolase-related",
"Type": "Domain"
},
{
"Beg": 50,
"End": 115,
"ID": "IPR011059",
"Name": "Metal-dependent hydrolase, composite domain superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 390,
... | MVRRIASATPMVQSPMSPLGTTYCVRPNPVSLNLQRRPLVIASTDEAKVTIIYAGLLIPGDGEPLRNAALVISDKIIAFVGSEADIPKKYLRSTQSTHRVPVLMPGLWDCHMHFGGDDDYYNDYTSGLATHPASSGARLARGCWEALQNGYTSYRDLAGYGCEVAKAINDGTIVGPNVYSSGAALSQTAGHGDIFALPAGEVLGSYGVMNPRPGYWGAGPLCIADGVEEVRRAVRLQIRRGAKVIKVMASGGVMSRDDNPNFAQFSPEELKVIVEEAARQNRIVSAHVHGKAGIMAAIKAGCKSLEHVSYADEEVWELMK... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Polyketide synthase, enoylreductase domain, GroES-like superfamily, Alcohol dehydrogenase-like, C-terminal, Alcohol dehydrogenase-like, N-terminal, NAD(P)-binding domain superfamily. The designed protein sequence is | [
{
"Beg": 4,
"End": 186,
"ID": "IPR011032",
"Name": "GroES-like superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 181,
"End": 301,
"ID": "IPR013149",
"Name": "Alcohol dehydrogenase-like, C-terminal",
"Type": "Domain"
},
{
"Beg": 33,
"End": 142,
"ID... | MASTTPSTYKQAVFKEQGAGLTLEEVALTLPKRDEILVKVEACGVCHSDHFAQTNLMGGGFPLVPGHEIIGRVAAVGEGETVWKEGDRIGGAWHGGHDGTCGACKKGFFQMCDNEQVNGISRNGGYAEYCIIRREAAVHIPDHVNAAKYAPMLCAGVTVFNAMRHMKIPPGELVAIQGLGGLGHLALQYANKFGYRVVALSRDSTKEEFARKLGAHEYIDTSREDPVAALQKLGGASLIVSTAPVPEIINPLIQGLGVMGKLLILSIVGGIEVHTGLLVGKGKSIWSWPSGHATDSEDAIAFADLHGIDCLIEEFPLDKC... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Cytochrome P450, Cytochrome P450 superfamily, Cytochrome P450 monooxygenase, fungi, Cytochrome P450, E-class, group I. The designed protein sequence is | [
{
"Beg": 39,
"End": 482,
"ID": "IPR001128",
"Name": "Cytochrome P450",
"Type": "Family"
},
{
"Beg": 67,
"End": 86,
"ID": "IPR002401",
"Name": "Cytochrome P450, E-class, group I",
"Type": "Family"
},
{
"Beg": 91,
"End": 112,
"ID": "IPR002401",
"Name": "... | MDILQLAPTHLLAILLSSTSALFLITYLLRAGHRPSDLPNGPPTVPLFGNELQVPKSDAHFQFSRWAKEYGGFFTLKRYNNTTIVISDQKLIKTLLDKKSNIYSHRPASLVSHLITQSDHLLVMQYGERWRMLRKTIHQYFMEPRCERDHWKVQEAEAKQMLHDYLTMPEDHMLHPKRYSNSITNSLVFGIRTKTVHDEYMKKLFYLMDKWSLVQELGATPPVDSFALLRYVPQWMLGNWRNRAVEVGDLMQSLYQTVLDQVKERRQRGIQRDSFMDRVLDTLKQTPLSENELRFLGGVLMEGGSDTSSSLILTIIQAMT... |
Generate a protein sequence for a novel protein that integrates the following function keywords: NTF2-like domain superfamily. The designed protein sequence is | [
{
"Beg": 55,
"End": 180,
"ID": "IPR032710",
"Name": "NTF2-like domain superfamily",
"Type": "Homologous_superfamily"
}
] | MKSSLWVSLAVSLIGLGPAAARNDYPGNYPSSSPPLGPTDWERTPVSVFAKVLNTQPDPDYNLLKELVTYDCTYISLTFDNPTLHGIMPWAGTHTHVGPQAFIDIFTRVGLYWDRGPFSIDHIFGDDGNVTAWGSFTATSRTLGKTVISPWAARARVNSANQIFEFQWMEDTFTTASSFGSDNSTKVFIANPEGGTAHA |
Generate a protein sequence for a novel protein that integrates the following function keywords: FAD linked oxidase, N-terminal, FAD-binding, type PCMH-like superfamily, Berberine/berberine-like, FAD-binding domain, PCMH-type, FAD-linked Oxidoreductases in Biosynthesis Pathways, FAD-binding, type PCMH, subdomain 2. The... | [
{
"Beg": 122,
"End": 261,
"ID": "IPR006094",
"Name": "FAD linked oxidase, N-terminal",
"Type": "Domain"
},
{
"Beg": 508,
"End": 551,
"ID": "IPR012951",
"Name": "Berberine/berberine-like",
"Type": "Domain"
},
{
"Beg": 115,
"End": 294,
"ID": "IPR016166",
... | MRLHQSPPRLLVCILSVLQVSAGLSSNCRCMPGDSCWPSLNDWARFNTSIGGRLVDTQPLGQPCHDPFYTASECNELKQQWTHPELHDASSSSIMSAAVANETCDAFTPRSKPCTLGAMVRYAVNASSPDDFVQTIRFSQERNIRLVIRNTGHDYAGKSTGAGALSIWTHSLKEIDFLNYTSAHYTGPAVRMTAGIQGTDINPAAHKKGLVIVGGECATVGPVGGFTQGGGHSALSSRFGLAADQVLEWEVVDGMGRLLTASPTQNPDLYWALSGGGGGTFGVVYAVTVKTFPDFAVTGVVLQFENIDPSSNRFFEAVGH... |
Generate a protein sequence for a novel protein that integrates the following function keywords: RmlC-like cupin domain superfamily, RmlC-like jelly roll fold. The designed protein sequence is | [
{
"Beg": 66,
"End": 217,
"ID": "IPR011051",
"Name": "RmlC-like cupin domain superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 39,
"End": 143,
"ID": "IPR014710",
"Name": "RmlC-like jelly roll fold",
"Type": "Homologous_superfamily"
}
] | MAPFVPYHYSAGQSTIVKFGGLLTTEFLEPPPGRCFLFRQTYRHTIEGSIPENLRKLINSPDRPKGPPPHFHQFQTEYFRVENGVLGISVDGVVRRITPEDGEISVKAGSVHNFFIHPDSPENMTVYLSASDSGNDYQLDRVFFENWYGYWHDALLHDGGIDWIQFLAIQDGGDAYTPAPAWVPFRRQVGYWTCVIVGRWIGGLLGYKPFFREYTTDWDFAVAKMKGSFFQRHLVHAAFEEEKSWTKQAELEPKGKPENAEFEPWTEDMSPAPLSLGPVAYEQGLFHGVQPGSVNGSNGHSTGVESKLEQLGSRAQRRVV... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Major facilitator superfamily, Major facilitator superfamily domain, MFS transporter superfamily. The designed protein sequence is | [
{
"Beg": 54,
"End": 438,
"ID": "IPR011701",
"Name": "Major facilitator superfamily",
"Type": "Family"
},
{
"Beg": 49,
"End": 545,
"ID": "IPR020846",
"Name": "Major facilitator superfamily domain",
"Type": "Domain"
},
{
"Beg": 45,
"End": 306,
"ID": "IPR0362... | MSIDASPSESVLESQTPDRVDESIPIKAEETEKDAAPGRDIVGFRWLLVCIAVFSANLLYGLDNTIVADIQAPIAGDFNEYTRLGWLGVGFTLGSVVFILPLGKAYAIFDTKWLFLGCLTMFAAGSALCGAAPSMNAIIVGRVWAGAGGAGMYLGNLNLITILTTPKEQPVYVGLVGLIYGTGCILGPIIGGAFSDSSATWRWSFYLNLVIFGVMSPIYVFLLPSLPRPAGEGRSFFKKLVELDWVGTVLSAGMHISIILFIVFGGVEWSWTDGRNIALYVVSAVLTIAFVLSQYFCIGTTKQDRLFPGEFLRDPTMLLL... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Short-chain dehydrogenase/reductase SDR, NAD(P)-binding domain superfamily. The designed protein sequence is | [
{
"Beg": 19,
"End": 254,
"ID": "IPR002347",
"Name": "Short-chain dehydrogenase/reductase SDR",
"Type": "Family"
},
{
"Beg": 11,
"End": 28,
"ID": "IPR002347",
"Name": "Short-chain dehydrogenase/reductase SDR",
"Type": "Family"
},
{
"Beg": 88,
"End": 99,
"ID... | MVLTTGLKGAHVLITGGTRGMGEAMVHKFLQEEANVSYCARTVTNTEYDDFYSTLAEGNTARAVGTAFDVASKDSLVKWVESSAERLGRIDVIIANASPMHMEGETEHWESSFAIDVMGFVELVKAATPYLEKSPQASIIVQSSFMGREFYRSPPAAYGPCKAAQLQHVQELSHFLGPKGIRVNAISPGPVLCKGGPWELYSKINPEWVEEQRLKIPLKRLGGPTEVANVAVFLASPLASFVSGTNMLVDGGIHVGTQF |
Generate a protein sequence for a novel protein that integrates the following function keywords: Polyketide synthase, beta-ketoacyl synthase domain, ACP-like superfamily, Acyl transferase domain superfamily, Polyketide synthase, C-terminal extension, Beta-ketoacyl synthase, C-terminal, Polyketide synthase, dehydratase ... | [
{
"Beg": 567,
"End": 864,
"ID": "IPR001227",
"Name": "Acyl transferase domain superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 1729,
"End": 1744,
"ID": "IPR006162",
"Name": "Phosphopantetheine attachment site",
"Type": "PTM"
},
{
"Beg": 1704,
"End": ... | MHSVSPSTYPSGGTSPAPADTPGTEYSEYEFSNDVAVVGMACRVAGGNHNPELLWQSLLSQKSAVGEIPEMRWEPYYRRDPRNAKELKKTTSRGYFLDRLEDFDCQFFGISPKEAEQMDPQQRVSLEVASEALEDAGIPAKSLSGSDTAVFWGVNSDDYSKLVLEDLPNVEAWMGIGTAYCGVPNRISYHLNLMGPSTAVDAACASSLVAVHHGVQAIRLGESQVAIVGGVNALCGPGLTRVLDKAGAISSDGSCKSFDDDAHGYARGEGAGALVLKSLHRALLDHDNVLAVIKGSAVAQDGKTNGIMAPNAKAQQLAAR... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Glucose-methanol-choline oxidoreductase, C-terminal, Glucose-methanol-choline oxidoreductase, N-terminal, Glucose-methanol-choline oxidoreductase, FAD/NAD(P)-binding domain superfamily. The designed protein sequence is | [
{
"Beg": 52,
"End": 368,
"ID": "IPR000172",
"Name": "Glucose-methanol-choline oxidoreductase, N-terminal",
"Type": "Domain"
},
{
"Beg": 327,
"End": 341,
"ID": "IPR000172",
"Name": "Glucose-methanol-choline oxidoreductase, N-terminal",
"Type": "Domain"
},
{
"Beg": ... | MRLTSGIFHAAIAVAAVGAVLPEGPSSSKTHRNEYARRMLGSSFGIPKNQTFDYLVIGGGTAGLTIATRLAEQGVGSVAVIEAGGFYELNNGNLSQIPAQDAFYVGTDLDDWQPGIDWGFHTTPQAGAYDRVSHYARGKCLGGSSARNYMAYQRGTKAAHQRWADTVGDSSYTWEQFLPFFEKSLHFTPANDALRGANASVVSDPSVLGNGDGPLSVTYPHYAQAFATWAKHAFIEIGLQIRSGFQSGALLGQSYGLYTINATTMHRESSETSFLRKGLADPNLTVFQSALAKRIRFQDKRAVGVDVETMGRAYTLSARK... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Acetate Uptake Transporter, Acetate transporter GPR1/Ato2/SatP-like. The designed protein sequence is | [
{
"Beg": 37,
"End": 222,
"ID": "IPR000791",
"Name": "Acetate transporter GPR1/Ato2/SatP-like",
"Type": "Family"
},
{
"Beg": 33,
"End": 238,
"ID": "IPR051633",
"Name": "Acetate Uptake Transporter",
"Type": "Family"
}
] | MKLSAEGTVMASSEEAAQLSCDTSSSHARNSKEQDFQPTQQIGSPTALGMGAFAIAFTTLSMSLMEWRSAAITNAYIGNCFFTAGMGLVLVAQWELVRGNSFGHTVFGGFGLFNLAFGAINAPAFGVADAFKDDPAALNNAIGYFLLVWGIFVLFFTVAAMPMNLVYTGMLGTSQITYTLLAASYFSFADDHASAGLALKKAAGAFGFVSGLFAWYTVGHLMCQDALLFSFPLGDTSPLYARLQRKKRH |
Generate a protein sequence for a novel protein that integrates the following function keywords: Cytochrome P450, Cytochrome P450 superfamily, Cytochrome P450 monooxygenase, fungi, Cytochrome P450, E-class, group I. The designed protein sequence is | [
{
"Beg": 32,
"End": 476,
"ID": "IPR001128",
"Name": "Cytochrome P450",
"Type": "Family"
},
{
"Beg": 60,
"End": 79,
"ID": "IPR002401",
"Name": "Cytochrome P450, E-class, group I",
"Type": "Family"
},
{
"Beg": 84,
"End": 105,
"ID": "IPR002401",
"Name": "... | MEPFLLLLLVLLPAIVLVRYAFTYGHRTSTMPIGPPTLPFIGNIHQITKKYTHIKFTEWAAQYGGLYMLKIGNGNMAVITDRRLVKEVLDRKSGIYSHRPHSFVSHDLITKGNHLLVMHYGDQWRTFRRLVHQHLMETMVENHHTKIVNAEAIQLVRDYMIDPEHHMAHPKRYSNSITNSIVFGIRTANREGANMRRLYKLMEEWSEVMETGATPPVDLFPWLKLLPQWLFNNYIDRAKAIGVQMETLYVDILNKVIKRREDGHNNGTFMDKVLDSQEKHNLPWHQLAFIGGVLMEGGSDTSSSLTLAIVQALIQNPDVQ... |
Generate a protein sequence for a novel protein that integrates the following function keywords: 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase, Amidohydrolase-related, Metal-dependent hydrolase. The designed protein sequence is | [
{
"Beg": 4,
"End": 313,
"ID": "IPR006680",
"Name": "Amidohydrolase-related",
"Type": "Domain"
},
{
"Beg": 1,
"End": 315,
"ID": "IPR032465",
"Name": "2-amino-3-carboxymuconate-6-semialdehyde decarboxylase",
"Type": "Family"
},
{
"Beg": 3,
"End": 313,
"ID": ... | MAKIDVHHHFYPPAMRQALDRAGGDPSGWYIPPWTLELDQDITRQMKVTTTILSVTAPGPGIEPDVTKAAALARSCNESAAAIRDAKPQQYGFFASVPSLFDTAAVLKEIEYACTTLRADGVTLFTRYGKGSNYLGHAAFRPIWADLSRRGAVVFIHPTHPVDTQLINTWLPQPMFDYPHETGRAAMDLLTSGILQDYPGCKIILSHAGGTLPYLIHRAATMLPLMPRTLGLSTEELVEAARTFYFDTAISSNPVTLKALFEFAAPGHVLFGSDFPNAPHDAILRFTNFLEAYELPEETKRQVDSGAALELFPRLKGILD... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Carboxylesterase type B, active site, Type-B Carboxylesterase/Lipase, Alpha/Beta hydrolase fold, Carboxylesterase, type B, Carboxylesterase type B, conserved site. The designed protein sequence is | [
{
"Beg": 40,
"End": 550,
"ID": "IPR002018",
"Name": "Carboxylesterase, type B",
"Type": "Domain"
},
{
"Beg": 138,
"End": 148,
"ID": "IPR019819",
"Name": "Carboxylesterase type B, conserved site",
"Type": "Conserved_site"
},
{
"Beg": 250,
"End": 265,
"ID": ... | MQIINWASLLLVTWETVVAAELPIVDLGYQRHQAIGFNSTGRYYQFSNVRYAEPPLGPLRFSLPVSPRNRSHEVVNGKGLGNICPQSQACWFNVQGDFVSAVTAGSTFNFTAAYDQVYQQDECTKPRPVADQNPLESEDCLFLDVYVPEKVISKRRDGNGKSNPGAPVLVYFQDGAYVSGSKSDQNPSGLIATSREDGSTGIIYVGVNYRLGVFGWLSGQKFQSEGGLPNAGLYDERLALEWVQRHITKFGGDPSRVTVMGVSAGGGSITMQLTAYGRAIRPPFAQIIAQSPAWEPGTKTPAIEDDLLDSFLTLLNVSSL... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Fungal Secondary Metabolite Regulators, Zn(2)-C6 fungal-type DNA-binding domain superfamily, Zn(2)Cys(6) fungal-type DNA-binding domain, Transcription factor domain, fungi. The designed protein sequence is | [
{
"Beg": 36,
"End": 70,
"ID": "IPR001138",
"Name": "Zn(2)Cys(6) fungal-type DNA-binding domain",
"Type": "Domain"
},
{
"Beg": 37,
"End": 64,
"ID": "IPR001138",
"Name": "Zn(2)Cys(6) fungal-type DNA-binding domain",
"Type": "Domain"
},
{
"Beg": 37,
"End": 66,
... | MYSTFSANFDTTIDASRDRSATPVTAPRPKRNQVARACDWCRLNRVRCDDKQPCQNCQNRGGSCSNTKPQEATSLPAANREMQRLRNKVKDLQDQIAKLKEGAEIQAQTGFATPPLSDAAHTSFDFAELTNTTEGWQGLQQTGQIHYGPLSSSYFVSRISRYLSQALNEPIEDAKLEACMARFHYIAPSHQPSRWDASPASQADQPQDGTEEAEDLTRSQEEHFLNLLWQSFHCVYPILDEREFQQYYESLWSSSPDGMSTRKPSALVDVLLAVCMQYSSTFFVSDDNQQGDTDSEWQAKHANLASRTYYQRAQRLLQSE... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Pheophorbide a oxygenase, Rieske [2Fe-2S] iron-sulphur domain superfamily, Cholesterol 7-desaturase, Rieske [2Fe-2S] iron-sulphur domain. The designed protein sequence is | [
{
"Beg": 292,
"End": 385,
"ID": "IPR013626",
"Name": "Pheophorbide a oxygenase",
"Type": "Domain"
},
{
"Beg": 76,
"End": 159,
"ID": "IPR017941",
"Name": "Rieske [2Fe-2S] iron-sulphur domain",
"Type": "Domain"
},
{
"Beg": 77,
"End": 188,
"ID": "IPR017941",
... | MEVLQASSLSFQLLRRHSRNNLINKFRNPSLPRIHMPRQNIDLKTFAAITPTVACPPSEPEIIPEKKEDKFEWYENWYPVASVCDLDKRRPHGRKVIGIDVVVWWDRKENAWKVFDDTCPHRLAPLSEGRIDQWGRLQCVYHGWCFDGAGACKFIPQAPHHGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIFLTKKPHYIPELDDPSFTCTMTTREVPYGYEILAENLMDPSHVPYAHYGILELEKVKESAKRDREGGHELEIRVGKIDVNGFSAKQVSADYYFVPPYLYYGRITPNTATKAIDVTLPVVPE... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Pheophorbide a oxygenase, Rieske [2Fe-2S] iron-sulphur domain superfamily, Cholesterol 7-desaturase, Rieske [2Fe-2S] iron-sulphur domain. The designed protein sequence is | [
{
"Beg": 296,
"End": 389,
"ID": "IPR013626",
"Name": "Pheophorbide a oxygenase",
"Type": "Domain"
},
{
"Beg": 80,
"End": 163,
"ID": "IPR017941",
"Name": "Rieske [2Fe-2S] iron-sulphur domain",
"Type": "Domain"
},
{
"Beg": 81,
"End": 192,
"ID": "IPR017941",
... | MPFPMEVLQASSLSFPLLRRHSRNNLINKFRNPTLPRIDIPRQNIDLKTFAATTPTVACPPSDPEIIPEKKEDKFDWYENWYPVATVCDLDKRRPHGRKVIGIDVVVWWDRKENAWKVFDDTCPHRLAPLSEGRIDQWGRLQCVYHGWCFDGVGACKFIPQAPHDGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIYLTNKPHYIPELDDPSFTCTTITREVPYGYEILAENLMDPSHVPYAHYGILELEKVKESSKRDREGGHEMEISVGTIDVNGFSAKHVSADYYFVPPYVYYGRITPNAATKTKDATLP... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Spexin. The designed protein sequence is | [
{
"Beg": 24,
"End": 51,
"ID": "IPR028126",
"Name": "Spexin",
"Type": "Family"
},
{
"Beg": 7,
"End": 51,
"ID": "IPR028126",
"Name": "Spexin",
"Type": "Family"
}
] | MISRVWILWTLVLFLLVTESHCIQKSSLSKNWGPQSMLYLKGKHGRRFVPDIDDHFISNSGLKSWYAVFK |
Generate a protein sequence for a novel protein that integrates the following function keywords: S-adenosyl-L-methionine-dependent methyltransferase superfamily, Cation-dependent O-methyltransferase, Class I-like SAM-dependent O-methyltransferase. The designed protein sequence is | [
{
"Beg": 27,
"End": 238,
"ID": "IPR002935",
"Name": "Class I-like SAM-dependent O-methyltransferase",
"Type": "Family"
},
{
"Beg": 14,
"End": 238,
"ID": "IPR002935",
"Name": "Class I-like SAM-dependent O-methyltransferase",
"Type": "Family"
},
{
"Beg": 7,
"End... | MGASIDDYCLIHKKILHSEDLLKYILETSAYPREHEQLKGLREVTEKHEWSSALVPADEGLFLSMLIKLMNAKRTIEIGVYTGYSLLTTALALPEDGKITAIDVNKSFFEIGLPFIQKAGVEHKINFIESEALPVLDQMLQETKEEDLYDYAFVDADKSNYANYHERLVKLVRIGGAILYDNTLWYGSVAYPEYPGLHPEEEVARLSFRNLNTFLAADPRVEISQVSIGDGVTICRRLY |
Generate a protein sequence for a novel protein that integrates the following function keywords: S-adenosyl-L-methionine-dependent methyltransferase superfamily, Cation-dependent O-methyltransferase, Class I-like SAM-dependent O-methyltransferase. The designed protein sequence is | [
{
"Beg": 27,
"End": 238,
"ID": "IPR002935",
"Name": "Class I-like SAM-dependent O-methyltransferase",
"Type": "Family"
},
{
"Beg": 14,
"End": 238,
"ID": "IPR002935",
"Name": "Class I-like SAM-dependent O-methyltransferase",
"Type": "Family"
},
{
"Beg": 7,
"End... | MGASIDDYCLIHKKILHSEDLLKYILETSAYPREHEQLKGLREVTEKHEWSSALVPADEGLFLSMLLKLMNAKRTIEIGVYTGYSLLTTALALPEDGKITAIDVNKSFFEIGLPFIQKAGVEHKINFIESEALPVLDQMLQETKEEDLYDYAFVDADKSNYANYHERLVKLVRIGGAILYDNTLWYGSVAYPEYPGLHPEEEVARLSFRNLNTFLAADPRVEISQVSIGDGVTICRRLY |
Generate a protein sequence for a novel protein that integrates the following function keywords: S-adenosyl-L-methionine-dependent methyltransferase superfamily, Cation-dependent O-methyltransferase, Class I-like SAM-dependent O-methyltransferase. The designed protein sequence is | [
{
"Beg": 27,
"End": 238,
"ID": "IPR002935",
"Name": "Class I-like SAM-dependent O-methyltransferase",
"Type": "Family"
},
{
"Beg": 14,
"End": 238,
"ID": "IPR002935",
"Name": "Class I-like SAM-dependent O-methyltransferase",
"Type": "Family"
},
{
"Beg": 6,
"End... | MGASIDDYSLVHKNILHSEDLLKYILETSAYPREHEQLKGLREVTEKHEWSSALVPADEGLFLSMLLKLMNAKRTIEIGVYTGYSLLTTALALPEDGKITAIDVNKSFFEIGLPFIQKAGVEHKINFIESEALPVLDQMLQETKEEDLYDYAFVDADKSNYANYHERLVKLVRIGGAILYDNTLWYGSVAYPEYPGLHPEEEVARLSFRNLNTFLAADPRVEISQVSIGDGVTICRRLY |
Generate a protein sequence for a novel protein that integrates the following function keywords: S-adenosyl-L-methionine-dependent methyltransferase superfamily, Cation-dependent O-methyltransferase, Class I-like SAM-dependent O-methyltransferase. The designed protein sequence is | [
{
"Beg": 27,
"End": 238,
"ID": "IPR002935",
"Name": "Class I-like SAM-dependent O-methyltransferase",
"Type": "Family"
},
{
"Beg": 14,
"End": 238,
"ID": "IPR002935",
"Name": "Class I-like SAM-dependent O-methyltransferase",
"Type": "Family"
},
{
"Beg": 6,
"End... | MGASIDDYSLVHKNILHSEDLLKYILETSAYPREHEQLKGLREVTEKHEWSSALVPADEGLFLSMLLKLMNAKRTIEIGVYTGYSLLTTALALPEDGKITAIDVNKSYYEIGLPFIQKAGVEHKINFIESEALPVLDQMLEEMKEEDLYDYAFVDADKSNYANYHERLVKLVRIGGAILYDNTLWYGSVAYPEYPGLHPEEEVARLSFRNLNTFLAADPRVEISQVSIGDGVTICRRLY |
Generate a protein sequence for a novel protein that integrates the following function keywords: S-adenosyl-L-methionine-dependent methyltransferase superfamily, Cation-dependent O-methyltransferase, Class I-like SAM-dependent O-methyltransferase. The designed protein sequence is | [
{
"Beg": 27,
"End": 237,
"ID": "IPR002935",
"Name": "Class I-like SAM-dependent O-methyltransferase",
"Type": "Family"
},
{
"Beg": 14,
"End": 238,
"ID": "IPR002935",
"Name": "Class I-like SAM-dependent O-methyltransferase",
"Type": "Family"
},
{
"Beg": 6,
"End... | MGASIDDYSLVHKNILHSEDLLKYILETSAYPREHEQLKGLREVTEKHEWSSALVPADEGLFLSMLLKLMNAKRTIEIGVYTGYSLLTTALALPEDGKITAIDVNKSFFEIGLPFIQKAGVEHKINFIESEALPVLDQMLQEMKEEDLYDYAFVDADKSNYANYHERLVKLVRIGGAILYDNTLWYGSVAYPEYPGLHPEEEVARLSFRNLNTFLAADPRVEISQVSIGDGVTIXRRLY |
Generate a protein sequence for a novel protein that integrates the following function keywords: UbiA prenyltransferase, UbiA prenyltransferase superfamily. The designed protein sequence is | [
{
"Beg": 150,
"End": 395,
"ID": "IPR000537",
"Name": "UbiA prenyltransferase",
"Type": "Family"
},
{
"Beg": 112,
"End": 301,
"ID": "IPR044878",
"Name": "UbiA prenyltransferase superfamily",
"Type": "Homologous_superfamily"
}
] | MLQMHSNSSFSPKCYYPLQHAGCVKTLQLPLTKVHGGLNRSESKNYAIKCTQSDSFYSTNKIRNNENSSSRNCKPFNKYRVAVTLQQQDCASNNEDDINSTSFRDVLLKKLHALYVFTRPFAMIGTIVGITSIAILPLQSFADLTPKYFMEFLKALLSAVLMNNYVGTVNQVADVEIDKVNKPGLPLASGDLSVGTGLAITLILSLTSLAIALSLQSPPLIFGLIVWFLLGTAYSVDLPFLRWKTNPFLAGMCMVIVFGLVYQFSFFIHFQKYVLGRPVVITRPLIFAAAIISTISAVMSLLKDIPDEDGDKQFGYQSIS... |
Generate a protein sequence for a novel protein that integrates the following function keywords: UbiA prenyltransferase, UbiA prenyltransferase superfamily. The designed protein sequence is | [
{
"Beg": 150,
"End": 395,
"ID": "IPR000537",
"Name": "UbiA prenyltransferase",
"Type": "Family"
},
{
"Beg": 112,
"End": 300,
"ID": "IPR044878",
"Name": "UbiA prenyltransferase superfamily",
"Type": "Homologous_superfamily"
}
] | MLQMHSNSSFSPKCYYPLQHAGCVKTLQLPLTKVHGGLNRSESKNYAIKCTQSDSFYSTNKIRNNENSSSRNCKPFNKYRVAVTLQQQDCASNNEDDINSTSFRDVLLKKLHALYVFTRPFAMIGTIVGITSIAILPLQSFADLTPKYFMEFLKALLSAVLMNNYVGTVNQVADVEIDKVNKPGLPLASGDLSVGTGLAITLILSLTSLAIALSLQSPPLIFGLIVWFLLGTAYSVDLPFLRWKTNPFLAGMCMVIVFGLVYQFSFFIHFQKYVLGRPVVITRPLIFAAAIISTISAVMSLLKDIPDEDGDKQFGYQSIS... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Six-hairpin glycosidase-like superfamily, N-acylglucosamine 2-epimerase/Cellobiose 2-epimerase, Six-hairpin glycosidase superfamily. The designed protein sequence is | [
{
"Beg": 3,
"End": 404,
"ID": "IPR008928",
"Name": "Six-hairpin glycosidase superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 34,
"End": 387,
"ID": "IPR010819",
"Name": "N-acylglucosamine 2-epimerase/Cellobiose 2-epimerase",
"Type": "Family"
},
{
"Beg": 2... | MTLWTARAAHRAWLDAEARRLVDFAAAADHPEHGFAWLDGSGAPLPEQGVHTWITCRVTHVAALAHLEGIPGASALADHGLRALAGPLRDPEHDGWFTALDSRGTVADSRKEAYQHAFVLLAAASATVAGRPGARELLDAAAAVIEQRFWEEETGRCRESWDAAWHADEPYRGANSNMHLVEAFLAAFDATGDRVWAERALRIAHFFVHEVAAPRDWRLPEHFTPDWQVVADYNTDDRAHPFRPYGVTVGHVLEWARLLVHVEAALPDPPSWLLADAEAMFAAAVARGWSVDGTEGFVYTLDYDDTPVVRSRMHWVVAEA... |
Generate a protein sequence for a novel protein that integrates the following function keywords: 3'5'-cyclic nucleotide phosphodiesterase, catalytic domain superfamily, 3'5'-cyclic nucleotide phosphodiesterase, conserved site, 3'5'-cyclic nucleotide phosphodiesterase, catalytic domain, HD/PDEase domain, 3'5'-cyclic nuc... | [
{
"Beg": 503,
"End": 727,
"ID": "IPR002073",
"Name": "3'5'-cyclic nucleotide phosphodiesterase, catalytic domain",
"Type": "Domain"
},
{
"Beg": 423,
"End": 751,
"ID": "IPR002073",
"Name": "3'5'-cyclic nucleotide phosphodiesterase, catalytic domain",
"Type": "Domain"
},
... | MKHMFKNILFHKKGKHDKNDAIKKAFSLFSVPSNENERIIKFWPLKFKEKDEETLYIIKLCDNMYSKKYVILVSHLISLLLMYSVCLIVGNINDLFSVLKLTYILLHTFTAINIILILTLHATHYVEMFKSIKGEIFIFYIMMIFVIWCSWLFILFNNIKDLLPIVVNVNNFLYATYANNKINIVLGFFAYLPIFYLITIIPCRICYSCAFDILFFIMKVAIFSVYYLITMKSYILTDNIFMIISALVGSLFIFVIRYIIEIQRRLSFHNWNKQTKQIIKLKKTLKEEKQKLSTTNIEEIYNLINDSIGNYYNENKKQKE... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Winged helix-like DNA-binding domain superfamily, Winged helix DNA-binding domain superfamily, Forkhead box domain-containing protein, Fork head domain, Fork head domain conserved site 2. The designed protein sequence is | [
{
"Beg": 118,
"End": 180,
"ID": "IPR001766",
"Name": "Fork head domain",
"Type": "Domain"
},
{
"Beg": 118,
"End": 131,
"ID": "IPR001766",
"Name": "Fork head domain",
"Type": "Domain"
},
{
"Beg": 139,
"End": 156,
"ID": "IPR001766",
"Name": "Fork head do... | MQSNDENIYFPANQYVNAGQYSPLQQSFSQNSQYDLFDGFAEFGFLEQVPTTNMHSFSQSTQMEQNCLPNVNNSTRKRKAPGQNEQATVKRRQIGIEKWRLPSRSVVQPSADISDLRRPPISYVALCALACRNAPDMKITPAGVYAFILHHWRYYRYANENWKNSVRHQLSSKEHFDEETFQPDPSNQTVRRKFYIVKNPNMIRQNLISDADFDFFRKDSRGIEFYQKMFAGQIGLPRSLFYQIIGNEIPFLAGPENSSMFYQLLGMGKVVGYLETRYFREHYRSEHAATEPKYEEDYANFTEKIPSNAENLMSYGAATE... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Periplasmic binding protein-like I, Adenylyl cyclase class-3/4/guanylyl cyclase, Cyclic nucleotide synthase, Protein kinase domain, Serine-threonine/tyrosine-protein kinase, catalytic domain, Nucleotide cyclase, Receptor, l... | [
{
"Beg": 464,
"End": 749,
"ID": "IPR000719",
"Name": "Protein kinase domain",
"Type": "Domain"
},
{
"Beg": 474,
"End": 750,
"ID": "IPR000719",
"Name": "Protein kinase domain",
"Type": "Domain"
},
{
"Beg": 813,
"End": 998,
"ID": "IPR001054",
"Name": "Ad... | MLLLLLLLKISTFVDSFQIGHLEFENSNETRILEICMKNAGSWRDHRLISLPSCHNFNGLENAANLNYQYSVDLLIGAACDEETQTVSRLALRWHKLYLSSAPLSTKEKESTTIALKPHSLAGTAEVILAMCKSMKWKEIGIIYSEETKYTAHAIYDMLAEQEDDLKINVFLETDGLSNTYTILHSARALISFLTTLDLSKFFKTLKENAFRPLEFSIVHVDCNKSEISNFYTYLDNNAGEEPNPISAARLRKLYRHVALLKNSHDDMEKTEEFAKKYGLVPSYTLYKALILCDGLQLLNNYTAPRGNLSIVQQLPYLWN... |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.