Instruction stringlengths 135 4.21k | Keywords listlengths 1 1.73k | Sequence stringlengths 8 35.2k |
|---|---|---|
Generate a protein sequence for a novel protein that integrates the following function keywords: Toll/interleukin-1 receptor homology (TIR) domain superfamily, Toll/interleukin-1 receptor homology (TIR) domain. The designed protein sequence is | [
{
"Beg": 138,
"End": 231,
"ID": "IPR000157",
"Name": "Toll/interleukin-1 receptor homology (TIR) domain",
"Type": "Domain"
},
{
"Beg": 133,
"End": 266,
"ID": "IPR000157",
"Name": "Toll/interleukin-1 receptor homology (TIR) domain",
"Type": "Domain"
},
{
"Beg": 134... | MSLEQKKGADIISKILQIQNSIGKTTSPSTLKTKLSEISRKEQENARIQSKLSDLQKKKIDIDNKLLKEKQNLIKEEILERKKLEVLTKKQQKDEIEHQKKLKREIDAIKASTQYITDVSISSYNNTIPETEPEYDLFISHASEDKEDFVRPLAETLQQLGVNVWYDEFTLKVGDSLRQKIDSGLRNSKYGTVVLSTDFIKKDWTNYELDGLVAREMNGHKMILPIWHKITKNDVLDYSPNLADKVALNTSVNSIEEIAHQLADVILNR |
Generate a protein sequence for a novel protein that integrates the following function keywords: FAD dependent oxidoreductase, FAD/NAD(P)-binding domain superfamily. The designed protein sequence is | [
{
"Beg": 6,
"End": 374,
"ID": "IPR006076",
"Name": "FAD dependent oxidoreductase",
"Type": "Domain"
},
{
"Beg": 6,
"End": 370,
"ID": "IPR036188",
"Name": "FAD/NAD(P)-binding domain superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 6,
"End": 380,
"... | MESIEAVVIGAGVVGLACARELARRGFETVILERHGAFGTETSARNSEVIHAGLYYPTDSLKARLCVAGRQQLYAFCATHAISHQRCGKLVVATSPAQESRLAALQKQGEANGVDDLQRLSAAEARALEPGLACTAALLSPSTGIVDSHGLMLALLGDAETAGAALALHSPLLRGSLDANTPGIVLESGGADGLRFKARRVINAAGLWAPQVAASLAGFPRTLIPANFHAKGSYYALTGRTPFSRLVYPLPEAGGLGVHLTLDLGGQARFGPDVEWLPDPTPGQPIDEPDYRVDPARADAFYAEIRRYWPALPDAALTPA... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Short-chain dehydrogenase/reductase SDR, NAD(P)-binding domain superfamily, Short-chain dehydrogenase/reductase, conserved site. The designed protein sequence is | [
{
"Beg": 4,
"End": 189,
"ID": "IPR002347",
"Name": "Short-chain dehydrogenase/reductase SDR",
"Type": "Family"
},
{
"Beg": 75,
"End": 86,
"ID": "IPR002347",
"Name": "Short-chain dehydrogenase/reductase SDR",
"Type": "Family"
},
{
"Beg": 127,
"End": 135,
"I... | MSTKFALVTGCGQGGIGEALITEYARRGIHAIATVLPAEPSDHLARAGITFFPLDVTNEESVLELKARVQKLTGGRLDVLVNCAGIAYTMTAIDTDVAAVQRMFNVNVFGPMRMVHHFHDMIIKATGAIVNIGSIGGVVPYLYGSSYNATKAALQHWSNTLRVEMAPFDVRVITVISGEVATNILKNDAHRRLPEGSYYSPLAENFRQHVTRTPPRTTDRFQYAANVVAESLRSSPSAWFWYGSQSTLIRFLDMFCWRTVWDSLFWRMFDLGKLKEAHSSKAKKQV |
Generate a protein sequence for a novel protein that integrates the following function keywords: Zn(2)-C6 fungal-type DNA-binding domain superfamily, Oleate Activated Transcription Factor 3, Zn(2)Cys(6) fungal-type DNA-binding domain. The designed protein sequence is | [
{
"Beg": 11,
"End": 45,
"ID": "IPR001138",
"Name": "Zn(2)Cys(6) fungal-type DNA-binding domain",
"Type": "Domain"
},
{
"Beg": 11,
"End": 41,
"ID": "IPR001138",
"Name": "Zn(2)Cys(6) fungal-type DNA-binding domain",
"Type": "Domain"
},
{
"Beg": 6,
"End": 50,
... | MDGKTYKLRASCNACNESKVRCSQTKPTCARCERNKTTCVYGLSRRTHKDAPPISLSHSHSHSHSGSQPHSHSGSRRSSVHIPNATATANATTTANYTSTTTPFMPLHENSMTSYPPQPSVDQFFAQQQPHHQQPSTAGPGPGILSPANLDLPSFMTPLPTPNEDHTNSLFSSFGNFAAGVGGVNGSVNNILTPLTGSPGTGTSASTSTDMFQQPQVQECTCHAGVMEQMASMSQPSRNEERRLSLDVQLSQLKRCIIASEASMGCGHHGNGDSEPINIISVAMLIGRIIDEFELMLNERIGRGTTMPERERSLSLDEAT... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Aromatic prenyltransferase, DMATS-type, Aromatic prenyltransferase DMATS-type, fungi, Aromatic prenyltransferase. The designed protein sequence is | [
{
"Beg": 2,
"End": 429,
"ID": "IPR012148",
"Name": "Aromatic prenyltransferase DMATS-type, fungi",
"Type": "Family"
},
{
"Beg": 22,
"End": 381,
"ID": "IPR017795",
"Name": "Aromatic prenyltransferase, DMATS-type",
"Type": "Family"
},
{
"Beg": 5,
"End": 423,
... | MALQTTNTWETLAQLLPSRNHDQDFWWKVTGRQLAVLLEAAGYPIERQYNTLLFHYHWAIPYLGPAPASGVAKWPSQLSVDGSPIEYSWKWNTKSKAPDVRYTMEPMSEFTGTKLDPLNQRAFRELLHKLSQFVPDVDLAPTDYFMSTLFDHDRSVLMKAVDDGVPLQFSSTALAFEFLDKGLLLKTYYAPRKLETGHFVLKDWDTAIRGYYPESKALDIVYEFLKTSPEGELMNPYHLAVDNVKDGRLKFYFQSPHRTFTSVREILTIGGRVQREGLEEQLLSLRDLLNALTGQSPDFPEDGEPPIVEEDVTADLDTDG... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Polyketide synthase, beta-ketoacyl synthase domain, ACP-like superfamily, GroES-like superfamily, Alcohol dehydrogenase-like, N-terminal, Acyl transferase domain superfamily, Polyketide synthase, C-terminal extension, Beta-... | [
{
"Beg": 534,
"End": 845,
"ID": "IPR001227",
"Name": "Acyl transferase domain superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 2320,
"End": 2398,
"ID": "IPR009081",
"Name": "Phosphopantetheine binding ACP domain",
"Type": "Domain"
},
{
"Beg": 1677,
"... | MNDDPPCIVGMACRLPGDVRSPSQLWDLVINQKTGQGPTPPIRYNVDGYYHPDGNRSGGINVPGGYFINEDIRQFDNGFFGINNLEATYMDPQQRKLLEVVFECFESTGASMKSMSGSNTGVYVGNFSVDYQPMQTRDADYLHRYTSTGSGATIMSNRISHVFNLHGPSFTLDTACSSSVYALHQALTAIKVGDCESAVVASANLIMSPELHIGAAKSGVLSPTGTCHTFDASADGYGRAEGVNAIYVKRLSAALRDGNQIRAIVRGSAVNANGRTPGIALPSGNLQEAVMRKAYQNAGLDFAETDYVECHGTGTPVGDP... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Short-chain dehydrogenase/reductase SDR, NAD(P)-binding domain superfamily. The designed protein sequence is | [
{
"Beg": 40,
"End": 184,
"ID": "IPR002347",
"Name": "Short-chain dehydrogenase/reductase SDR",
"Type": "Family"
},
{
"Beg": 41,
"End": 58,
"ID": "IPR002347",
"Name": "Short-chain dehydrogenase/reductase SDR",
"Type": "Family"
},
{
"Beg": 118,
"End": 129,
"... | MAVTFDISPEKEAGVLRLFHSQLFVTPPPLTRRDVDLSGKTAIVTGANGGLGLETAHQLLDLGCKVILAVRRVERGEAARQKLLEGRDAQATEIEVWPLDLSSYESVVGFAERAKTLSRLDIAILNAGLYKVNQTMTASTGYEESIHVNYLANALLITLLAPIFKNKKTGNTPGRIVLVSSDLAAWAKFKERKSNPILPTFKQKMTPKWDYLERYGTSKVLGQFFVTELAKRVSPDAVLVTTTNCGLCHGSELSREGQGHLIGYVFNVVSRLFGRSCSVGARVFVHAAANPVLGASVHGQYVEDAKLKPMSPLIYKPGDL... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Cytochrome P450, Cytochrome P450 superfamily, Cytochrome P450 monooxygenase, fungi, Cytochrome P450, E-class, group I. The designed protein sequence is | [
{
"Beg": 31,
"End": 470,
"ID": "IPR001128",
"Name": "Cytochrome P450",
"Type": "Family"
},
{
"Beg": 59,
"End": 78,
"ID": "IPR002401",
"Name": "Cytochrome P450, E-class, group I",
"Type": "Family"
},
{
"Beg": 83,
"End": 104,
"ID": "IPR002401",
"Name": "... | MITASSAILLVALIAALWRLSLIGQRPKDYPPGPPTLPILGNLHQIPKARRHIQFEKWARQYGPVYSLILGTKVMIVLNTEDAIRELVDKRGAIYASRPESFIAQDTISGGLRILWMHNGETWKMVRKLAHRILNITTARTYVPYQDLETKRMLVDFLEKPDSFIEHMRRFSTSLTTQMTFGFRTTTIHDPRFKESFDIFDESWELVASPVAALMDFFPFLRKIPDFLLPVKREAKKLHQREITLFRDHYFETRRKLQDGTAKPCVCVDLMKLQKEESFSDNLAAYIGGSLLQAGSETTAGVLVGFIQAITIFPSVAKIA... |
Generate a protein sequence for a novel protein that integrates the following function keywords: FAD linked oxidase, N-terminal, FAD-linked Oxidoreductases in Biosynthetic Pathways, FAD-binding, type PCMH-like superfamily, Berberine/berberine-like, FAD-binding domain, PCMH-type, FAD-binding, type PCMH, subdomain 2. The... | [
{
"Beg": 65,
"End": 198,
"ID": "IPR006094",
"Name": "FAD linked oxidase, N-terminal",
"Type": "Domain"
},
{
"Beg": 448,
"End": 489,
"ID": "IPR012951",
"Name": "Berberine/berberine-like",
"Type": "Domain"
},
{
"Beg": 59,
"End": 229,
"ID": "IPR016166",
"... | MRRNILTALACSWLTAHAASVDLKSLLLESDIQWASDTVISFSDTPEFEDATVRWNSYNAPTYAGAISPADEEDVVKVVKLAKEHNVPFLATGGRHGCTDMVGLQEGLAIDLSQINSYEVDSDDATVTVGAGSTFGQFQNAIHDAGFMIQSGSVTCPGFIGITLGGGIGRYTGIFGLEIDALISARIVTADGEVLTISETENAELFWGVRGAGFNFGIVTSATYKLHKLADNNNGEILTADFIIPANKTLFYFDWLESLGETMPPNAAGVSRFQFDSIAKEGQIGANWVFIGPEDEGREFLSPILDLQPSVAMLSYVPWN... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Aromatic prenyltransferase, DMATS-type, Aromatic prenyltransferase DMATS-type, fungi, Aromatic prenyltransferase. The designed protein sequence is | [
{
"Beg": 3,
"End": 415,
"ID": "IPR012148",
"Name": "Aromatic prenyltransferase DMATS-type, fungi",
"Type": "Family"
},
{
"Beg": 16,
"End": 365,
"ID": "IPR017795",
"Name": "Aromatic prenyltransferase, DMATS-type",
"Type": "Family"
},
{
"Beg": 4,
"End": 405,
... | MPSEVLTSYYDYPTHDQEAWWRDTGPLFGRFLKGAGYDVHTQYQYLVFFIKNILPSLGPYPARWRSTITPTGLPIEYSLNFQLNSRPLLRIGFEPLSRFSGTPQDPYNKIAAADLLNQLSKLQLHEFDTQLFNHFTNEFELSKSESESLQKQGGINGKSTVRSQTAFGFDLKGGRVAVKGYAFAGLKNRATGTPVGQLISNSIRNLEPQMHCWDSFSILNSYMEESDGWNEYSFVSWDCVDIERSRLKLYGVHNAVTWDKVKEMWTLGGRIENNATIKTGLELLQHMWSLLQINEGDRDYKGGFAADNGGKTLPIIWNYE... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Aromatic prenyltransferase, DMATS-type, Aromatic prenyltransferase DMATS-type, fungi, Aromatic prenyltransferase. The designed protein sequence is | [
{
"Beg": 1,
"End": 408,
"ID": "IPR012148",
"Name": "Aromatic prenyltransferase DMATS-type, fungi",
"Type": "Family"
},
{
"Beg": 18,
"End": 369,
"ID": "IPR017795",
"Name": "Aromatic prenyltransferase, DMATS-type",
"Type": "Family"
},
{
"Beg": 2,
"End": 406,
... | MQPYHTLSRVLPFPDANQKAWWDKLGPMLLKAMQSQGYDTEAQYAQLGMVYKCVLPYLGEFPTVENDATRWKSFLCPYGIPIEPSLNISQGILRYAFEPIGPDVGTEKDPQNMNIIQDCLKGLTQHDDRIDTTLHAEFSSRLLLTEEESRQFATTGQFNFGPGQGMHGFAVDLKGSRPMFKGYFCAGIKSVVTGIPTGKLMLDAVREVDTEGRITQPLDKLEEYSANGIGKLMLCFMSVDMVNPHDARIKMYGLQQEVSREGIVDLWTLGGRVNTPTNQEGLELLLELWDLLQIPAGPRSVAISHCSVGQPPEYMLPTLV... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Condensation domain, Phosphopantetheine attachment site, ACP-like superfamily, AMP-binding, conserved site, AMP-binding enzyme, C-terminal domain superfamily, Phosphopantetheine binding ACP domain, ANL, N-terminal domain, A... | [
{
"Beg": 14,
"End": 356,
"ID": "IPR000873",
"Name": "AMP-dependent synthetase/ligase domain",
"Type": "Domain"
},
{
"Beg": 1069,
"End": 1394,
"ID": "IPR000873",
"Name": "AMP-dependent synthetase/ligase domain",
"Type": "Domain"
},
{
"Beg": 624,
"End": 1016,
... | MGSIESDSVLSFFSQRCCQNPDNTAIDDGPNGKLSYSQLDQQSSALAYCLQQNGITAGQVIPLLTTSRLEMVIAVLGILKAGGVYVPIDVDQWPADRINYVLSRTCSGLVVYTGDNIPSGVSLEEECRTVQVQIWPESALETQYEPNRRPQLMCIIFTSGTTDKPKGVMIPHSSVARFVTSPGFNYDIVPGDRLLLVLSVAFDGMGTLFNTICNGGTVILANRLNFQERSRQCTVLVVTPSILDVLSPPQSPSDYPSLERIFLGGETPSQQLLEAWSAFNDVALWIAYGPTEATCAVLSGRLQASSETGKFHPTRLGHCI... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Cytochrome P450 superfamily, Cytochrome P450 monooxygenase, fungi, Cytochrome P450, Cytochrome P450, E-class, group I, Cytochrome P450, conserved site. The designed protein sequence is | [
{
"Beg": 50,
"End": 492,
"ID": "IPR001128",
"Name": "Cytochrome P450",
"Type": "Family"
},
{
"Beg": 326,
"End": 339,
"ID": "IPR001128",
"Name": "Cytochrome P450",
"Type": "Family"
},
{
"Beg": 361,
"End": 372,
"ID": "IPR001128",
"Name": "Cytochrome P450... | MWDSPIIFTTMRELVQSVSPAALSWAVVAIYLGTFFWLRSRSSKQRLPLPPGPRGLPLIGNSLQTPAVNPWEKYKEWSDEYGPVMTLSLGLTTTIILSSHQVANDLMEKKSTIYSSRPQLVMFNRLSGGMNSSGMEYGKRWRDHRSLQASVLRPWMTQRYTALRDVETKQLLAELLNTDDFSSCFKRMVASLFMTLAYGKRVQYPDDPEIRGMEELVRVKSEAGEASFRATGQLVEYIPLLQYLPSFLTPWKEMCDRICEQFNKTFVDRLRDGINAPAWTWAKEVSKHKVARPMSELEISYTLGTLYEASLTSQQILRII... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Evasins Class A. The designed protein sequence is | [
{
"Beg": 38,
"End": 110,
"ID": "IPR045797",
"Name": "Evasins Class A",
"Type": "Family"
}
] | MKVLLYIAASCLMLLALNVSAENTQQEEEDYDYGTDTCPFPVLANKTNKAKFVGCHQKCNGGDQKLTDGTACYVVERKVWDRMTPMLWYSCPLGECKNGVCEDLRKKEECRKGNGEEK |
Generate a protein sequence for a novel protein that integrates the following function keywords: Evasins Class A. The designed protein sequence is | [
{
"Beg": 38,
"End": 110,
"ID": "IPR045797",
"Name": "Evasins Class A",
"Type": "Family"
}
] | MKVLLCIAASCLMLLALNVSAENTQQEEQDYDYGTDTCPFPVLANKTNKAKFVGCHQKCNGGDQKLTDGTACYVVERKVWDRMTPMLWYECPLGECKNGVCEDLRKKEDCRKGNGEEK |
Generate a protein sequence for a novel protein that integrates the following function keywords: Evasins Class A. The designed protein sequence is | [
{
"Beg": 37,
"End": 111,
"ID": "IPR045797",
"Name": "Evasins Class A",
"Type": "Family"
}
] | MKASFCVIASCLVVFALKGTAEDTGTEDDFDYGNTGCPFPVLGNYKSNMTKPVGCKNKCGSGYEVLNDTTPCYVIDQKVFNNMVPLRQYSKCPLGFCENGECKPNDQAEDCYKGREEQK |
Generate a protein sequence for a novel protein that integrates the following function keywords: Evasins Class A. The designed protein sequence is | [
{
"Beg": 55,
"End": 128,
"ID": "IPR045797",
"Name": "Evasins Class A",
"Type": "Family"
}
] | MHSTIVYACLLALAVFVALHGTPLAALAENGEGTTQPDYDNSTDYYNYEDFKCTCPAPHLNNTNGTVMKPIGCYYTCNVTRCTAPDTYPCYNLTEHQAKNLTTSPTTLCAVGNCDHGICVPNGTKELCFKAPNLEE |
Generate a protein sequence for a novel protein that integrates the following function keywords: Evasins Class A. The designed protein sequence is | [
{
"Beg": 48,
"End": 123,
"ID": "IPR045797",
"Name": "Evasins Class A",
"Type": "Family"
}
] | MHSTIAYVSLLPLALFVAMHGASTDEESEELGASTDVDYEELDANCTCPAPALTSTRNNKHYPLGCIYNCSSYNCTIPDGTPCYVLTLGEVKEHLQIGSTVPNCTCGLCRNGTCVSNGTVEECFAVEEIEET |
Generate a protein sequence for a novel protein that integrates the following function keywords: Evasins Class A. The designed protein sequence is | [
{
"Beg": 38,
"End": 109,
"ID": "IPR045797",
"Name": "Evasins Class A",
"Type": "Family"
}
] | MARNWSFRVIFVSAMWCALLKFATLEEPKDGYDYTEGCPFVVLGNGTHAKPAGCSHLCNGAPETLDDNMECYNVTEEVAKRMTPDIPYTCWLGWCSKGECKRDNRTEVCYRGSERE |
Generate a protein sequence for a novel protein that integrates the following function keywords: Evasins Class A. The designed protein sequence is | [
{
"Beg": 38,
"End": 108,
"ID": "IPR045797",
"Name": "Evasins Class A",
"Type": "Family"
}
] | MTRNWSFRVIFVSAMWCALLKFATLEAPKDDFEYDGGCPFVVLDNGTHVKPAGCSHLCNGAPETLDNIECYNVTEEVAKRMTPGIPYACWLGWCSKGECKRDNRTEVCYRGSEEE |
Generate a protein sequence for a novel protein that integrates the following function keywords: Leguminous Lectin, Legume lectin, beta chain, Mn/Ca-binding site, Legume lectin domain, Legume lectin, alpha chain, conserved site, Concanavalin A-like lectin/glucanase domain superfamily. The designed protein sequence is | [
{
"Beg": 85,
"End": 94,
"ID": "IPR000985",
"Name": "Legume lectin, alpha chain, conserved site",
"Type": "Conserved_site"
},
{
"Beg": 3,
"End": 123,
"ID": "IPR001220",
"Name": "Legume lectin domain",
"Type": "Domain"
},
{
"Beg": 126,
"End": 235,
"ID": "IPR... | ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQNGKVGTAHIIYNSVGKRLSAVVSYPNGDSATVSYDVDLDNVLPEWVRVGLSATTGLYKETNTILSWSFTSKLKSNSTHETNALHFMFNQFSKDQKDLILQGDATTGRDGNLELTRVSSNGSPQGSSVGRALFYAPVHIWESSAVVASFDATFTFLIKSSDSHPADGIAFFISNIDSSIPSGSTGRLLGLFPDAN |
Generate a protein sequence for a novel protein that integrates the following function keywords: CdiI, C-terminal, Contact-dependent growth inhibition immunity. The designed protein sequence is | [
{
"Beg": 35,
"End": 139,
"ID": "IPR040509",
"Name": "CdiI, C-terminal",
"Type": "Domain"
},
{
"Beg": 1,
"End": 145,
"ID": "IPR053755",
"Name": "Contact-dependent growth inhibition immunity",
"Type": "Homologous_superfamily"
}
] | MFGIFSKGEPVSMEGELVQPSSIVINDYEEELHLPLSYWDIKDYKNSWLKSLGEGLSNKTHSALAVSMYEPEKTNFIFTWVLYFEDEKVYVQNNVIFLEECHGFSPENINKFIESRTTHDGDGMKISEWHTDLNSVLDFYHSLNN |
Generate a protein sequence for a novel protein that integrates the following function keywords: Isopenicillin N synthase-like, Fe(2+) 2OG dioxygenase domain, Oxoglutarate/iron-dependent dioxygenase domain, Non-haem dioxygenase N-terminal domain, Isopenicillin N synthase-like superfamily. The designed protein sequence ... | [
{
"Beg": 209,
"End": 319,
"ID": "IPR005123",
"Name": "Oxoglutarate/iron-dependent dioxygenase domain",
"Type": "Domain"
},
{
"Beg": 66,
"End": 166,
"ID": "IPR026992",
"Name": "Non-haem dioxygenase N-terminal domain",
"Type": "Domain"
},
{
"Beg": 20,
"End": 350... | MAPTKDFSTTTTNGAESWDDVADFVTKKGHGVKGLSERGIKTLPKPFHQPLEERFSEKKILERASIPLIDMSQWDSPEVVKSICDAAENWGFFQIVNHGVPLETLERVKEATHRFFGLPAEEKNNYSKENSPINNVRFGSSFVPHVEKALEWKDFLSMFYVSEEETNTYWPPICRDEMLEYMRSSEVLIQRLMEVLVVKGLKVKQIDEIREPMLVGSRRINLNYYPKCPNPELTLGVGRHSDISTFTILLQDQIGGLHVRKLDDTGNTWVHVTPIAGSLIINIGDALQIMSNGRYKSIEHMVVANGTQDRISVPLFVNPK... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Isopenicillin N synthase-like, Fe(2+) 2OG dioxygenase domain, Oxoglutarate/iron-dependent dioxygenase domain, Non-haem dioxygenase N-terminal domain, Isopenicillin N synthase-like superfamily. The designed protein sequence ... | [
{
"Beg": 215,
"End": 318,
"ID": "IPR005123",
"Name": "Oxoglutarate/iron-dependent dioxygenase domain",
"Type": "Domain"
},
{
"Beg": 65,
"End": 165,
"ID": "IPR026992",
"Name": "Non-haem dioxygenase N-terminal domain",
"Type": "Domain"
},
{
"Beg": 19,
"End": 349... | MAPTKDFSTATNGADSWDDVADFVTKKGHGVKGLSERGIKTLPKPFHQPLEERFSEKKILERASIPLIDMSEWDSPEVVKSICDAAENWGFFQIVNHGVPLETLERVKEATHRFFGLPAEEKNKYSKENSPINNVRFGSSFVPHVEKALEWKDFLSMFYVSXEETNTYWPPICXDQMLEYMRSSEVLIKRLMEVLVVKGLKVKQIDEIREPMLVGSRRVNLNYYPKCPNRELTLGVGRHSDISTFTILLQDQIEVLHVRKLDDTGNTWVHVTPIAGSLIINIGDALQIMSNGRYKSIEHMVVANGTQDRISVPLFVNPKP... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Short-chain dehydrogenase/reductase SDR, NAD(P)-binding domain superfamily. The designed protein sequence is | [
{
"Beg": 49,
"End": 231,
"ID": "IPR002347",
"Name": "Short-chain dehydrogenase/reductase SDR",
"Type": "Family"
},
{
"Beg": 113,
"End": 124,
"ID": "IPR002347",
"Name": "Short-chain dehydrogenase/reductase SDR",
"Type": "Family"
},
{
"Beg": 174,
"End": 182,
... | MIPRWQPASIPLLLHLDTLRCHHVSVQPPRATMTSLNIKEEDIPRLDGKVVVISGGASGIGLAAANIFARAGAKIFLFDCNPPDSGEAPENSTFIKADITSWAELKAAFAQAGHVDIAVANAGVSEEQPYFEDTFDEQGELKEPGFAVVDVNFKGTVMFTKLAVSYMRKQGKGGSVVITASATGYAPEQNLPVYSAIKSGLVGLVRSLRSTLPRFDISINAVAPAATITKLLPMDIAGPLMAAGLPVSSAHMVGLAVVYSAVARQPRMVETYGKENVLDLESKWNGRTILTLGEHYTELEEKLADLRPVWFGWRNTDLTK... |
Generate a protein sequence for a novel protein that integrates the following function keywords: FAD linked oxidase, N-terminal, FAD-linked Oxidoreductases in Biosynthetic Pathways, FAD-binding, type PCMH-like superfamily, FAD-binding domain, PCMH-type, FAD-binding, type PCMH, subdomain 2. The designed protein sequence... | [
{
"Beg": 67,
"End": 201,
"ID": "IPR006094",
"Name": "FAD linked oxidase, N-terminal",
"Type": "Domain"
},
{
"Beg": 63,
"End": 235,
"ID": "IPR016166",
"Name": "FAD-binding domain, PCMH-type",
"Type": "Domain"
},
{
"Beg": 34,
"End": 265,
"ID": "IPR016169",
... | MLSLKAFLALSLSIHLSQGLVASVSHRRANACTELSRSYPDSTIHPGSSVFAEDVIEPWSQTCQTTPTCVFAPASAEEVAGGLAILRKADQTFAVRTQGHMPIPGAADISNGVLMVTTSLNSVQYADDSKSVVQIGAGNRWLDVYKVLAKDNLAVVGGRFGQVGVSGLLLGGGISYFNSDHGWGANSVVNYEVVLANGTVCAANAQQNSDLYWALKGGSFNFGIVTRFDLATFSVPYMWGGSAFYDASALDPLVNAYASYAVASGGSSDPAAHSDPSILYNVTTGEVSGYGIYMHRGDDPAPAALKNFTDIPSTFQDFRV... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Short-chain dehydrogenase/reductase SDR, NAD(P)-binding domain superfamily. The designed protein sequence is | [
{
"Beg": 49,
"End": 252,
"ID": "IPR002347",
"Name": "Short-chain dehydrogenase/reductase SDR",
"Type": "Family"
},
{
"Beg": 50,
"End": 67,
"ID": "IPR002347",
"Name": "Short-chain dehydrogenase/reductase SDR",
"Type": "Family"
},
{
"Beg": 123,
"End": 134,
"... | MANPLISNHIGKHGKYTQAFLEQNGPGDARPTALDILKDNDRIDNMKDKVFLLTGSSGGIGIETGRALAATGGKVYLGVRDLEKGKQALAEILEPGRVELLELDVGSMESVRTAAKTFLSKSTQLNVLVNNAGIMACPEAKTVDGFESQLAINYLGHFLLYKLLEQTLLSSSTPEFQSRVVNVSSAGHHMSSVVLDNINLEGEYEPWKAYGNAKTACIWMTNEIEHRYGSKGLHGLSLMPGGIATSLQRHVDPETLKEWGSSEFAQKYAKSSAQGAATTITAALGKEWEGKGGVYLEDCQEAGPVPEGGTLAVGVAPHAF... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycosyl hydrolase family 81, N-terminal, Glycosyl hydrolase family 81, C-terminal domain, Endo-1,3(4)-beta-glucanase. The designed protein sequence is | [
{
"Beg": 31,
"End": 759,
"ID": "IPR005200",
"Name": "Endo-1,3(4)-beta-glucanase",
"Type": "Family"
},
{
"Beg": 26,
"End": 744,
"ID": "IPR005200",
"Name": "Endo-1,3(4)-beta-glucanase",
"Type": "Family"
},
{
"Beg": 51,
"End": 377,
"ID": "IPR040451",
"Nam... | MRFQVIVAAATITMITSYIPGVASQSTSDGDDLFVPVSNFDPKSIFPEIKHPFEPMYANTENGKIVPTNSWISNLFYPSADNLAPTTPDPYTLRLLDGYGGNPGLTIRQPSAKVLGSYPPTNDVPYTDAGYMINSVVVDLRLTSSEWSDVVPDRQVTDWDHLSANLRLSTPQDSNSYIDFPIVRGMAYITANYNNLTPQFLSQHAIISVEADEKKSDDNTSTFSGRKFKITMNDDPTSTFIIYSLGDKPLELRKQDNSNLVASKPYTGVIRVAKLPAPEFETLLDASRAVWPTGGDISARSDDNNGASYTIKWKTNSNEA... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 31,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPVWIGYSPCVGDDCIALLTRGEGLC |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 30,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATCLPAWLALCPCVGDDVNPTLTRGGT |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 30,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINGTRLPWLATCPCVGEDVNPTLSRGER |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 32,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPIWGIGCDPCVGDDVTAVLTRGEA |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 32,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPIWGIGCNPCVGDEVTALLTRGEA |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 31,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPVWIGYSPCVGDDAVALLNRGEG |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 32,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPLILLAALGIPSDDADSTLTRGER |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 32,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPIWGIGCDPCVGDEVTALLTRGEA |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 32,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPIWGIGCNPSVGDEVTALLTSGEA |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 31,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPHLVRYPPYVGDGTDLTLNRGEK |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 32,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPIFWFIYFPCVGDNVDNTLTRGER |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 32,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPIWGIGCDPCVGDEVTALLTRGEA |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 31,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPAWLVDCPCVGDDINRLLTRGEK |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 31,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPVWIGCSPCVGDDCIALLTRGEG |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 31,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPSFFFPIPCISDDIEMVLTRGER |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 31,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRVPAWLAECPCVGDDISHLLTRGEK |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 32,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPIWGIGCDPCVGDEVTALLTRGEA |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 32,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPIWGIGCNPCVGDEVTALITRGEA |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 31,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPIIWAPVVPCISDDNDSTLTRGQR |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 32,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPIILAPIIPCINDDVNSTLTSGER |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 34,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPIIIVLGLIIPLCVSDIEMILTRGER |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 32,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPIWGIGCDPCVGDDVAALTTRGEA |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 32,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | MSDINATRLPIWGIGCNPSVGDEVTALLASGEA |
Generate a protein sequence for a novel protein that integrates the following function keywords: P-loop containing nucleoside triphosphate hydrolase, Helicase, C-terminal domain-like. The designed protein sequence is | [
{
"Beg": 2,
"End": 41,
"ID": "IPR001650",
"Name": "Helicase, C-terminal domain-like",
"Type": "Domain"
},
{
"Beg": 1,
"End": 64,
"ID": "IPR027417",
"Name": "P-loop containing nucleoside triphosphate hydrolase",
"Type": "Homologous_superfamily"
},
{
"Beg": 2,
"... | MQVLIGTKLVTEGIDIKQLMMVIMLDNRLNIIELIQGVGRLRDGGLCYLLSRKNSWAARNRKGELPPIKEGCITEQVREFYGLESKKGKKGPACWMLWLQDRPVC |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 22,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | PAWLVDCPCVGDDVNRLLARGEK |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 22,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | PAWLVDCPCVGDDISRLLTRGEK |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 22,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | PAWLVDCPCVGDDVNRLLTRGER |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 22,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | PAWLVDCPCVGDDINRLLTRGEK |
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is | [
{
"Beg": 1,
"End": 21,
"ID": "IPR027582",
"Name": "Amanitin/phalloidin toxin",
"Type": "Family"
}
] | PAWLVDCPCVGDDVNFILTRGQK |
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycoside hydrolase superfamily, Glycoside hydrolase, family 5, conserved site, Glycoside hydrolase, family 5. The designed protein sequence is | [
{
"Beg": 23,
"End": 304,
"ID": "IPR001547",
"Name": "Glycoside hydrolase, family 5",
"Type": "Domain"
},
{
"Beg": 25,
"End": 317,
"ID": "IPR017853",
"Name": "Glycoside hydrolase superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 151,
"End": 160,
"I... | MPRMLAASAAIIATTLAPLSAQAAGCEMTLHGINLSGAEFGQPGDPYGQGYIYPSESTIKAFADDGFNAVRLPFLWERLQPTLNGTLDATELSRIKDTVETLRDNGMVVILDVHNYARYHGEMIGTPNVPVAAFADFWKRLSAVFANDDDVIFGLMNEPHDISAPAWLAAANAAIDAIRTIGAGNLVLVPGTAWTGAHSWSQTFYGPSNASVMAQVVDSSNNFAYEVHQYTDDDFSGKNADCSKIDDAVSALNDFTSWLNANDVQGFLGEFGTTEQIQCLRGLKQMVDVVQQNPRAWLGWAYWAGGDWWPKDSPMIIHSN... |
Generate a protein sequence for a novel protein that integrates the following function keywords: D-aminoacyl-tRNA deacylase-like superfamily, D-aminoacyl-tRNA deacylase DTD. The designed protein sequence is | [
{
"Beg": 1,
"End": 145,
"ID": "IPR003732",
"Name": "D-aminoacyl-tRNA deacylase DTD",
"Type": "Family"
},
{
"Beg": 2,
"End": 144,
"ID": "IPR003732",
"Name": "D-aminoacyl-tRNA deacylase DTD",
"Type": "Family"
},
{
"Beg": 1,
"End": 147,
"ID": "IPR003732",
... | MKLVVQRVTDASVTVDGAVAGRIGPGIMALVGVTHEDTEEDAAYLADKIVNLRIFDDESGKMNLSLLDTGGEILSVSQFTLYGETKKGRRPNFMNAAKPDQALLLYEKWNELLREKGVKVETGIFGAMMDVQLTNSGPVTLIMDSKQ |
Generate a protein sequence for a novel protein that integrates the following function keywords: Plant defense and hormone signaling protein, START-like domain superfamily, Bet v I/Major latex protein, Bet v I type allergen. The designed protein sequence is | [
{
"Beg": 1,
"End": 155,
"ID": "IPR000916",
"Name": "Bet v I/Major latex protein",
"Type": "Domain"
},
{
"Beg": 2,
"End": 159,
"ID": "IPR023393",
"Name": "START-like domain superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 3,
"End": 23,
"ID": "IPR0... | MGVFTYETEFTSVIPPPRLYKAFVLDADNLIPKIAPQAVKSAEIVQGDGGVGTIKKIHLGEGSEYSYVKHQIDGLDKDNFVYNYSIIEGDAIGDKVEKISYEIKLVASPSGGSIIKSTSHYHCKGEVEIKEEHVKAGKEKAAGLFKIIENHLLANPEAYN |
Generate a protein sequence for a novel protein that integrates the following function keywords: Plant defense and hormone signaling protein, START-like domain superfamily, Bet v I/Major latex protein, Bet v I type allergen. The designed protein sequence is | [
{
"Beg": 1,
"End": 155,
"ID": "IPR000916",
"Name": "Bet v I/Major latex protein",
"Type": "Domain"
},
{
"Beg": 2,
"End": 158,
"ID": "IPR023393",
"Name": "START-like domain superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 3,
"End": 23,
"ID": "IPR0... | MGVFTYETEFTSVIPPPRLFKAFILDADNLIPKIAPQAVKCAEIIEGDGGVGTIKKITFGEGSQFGSVTHKIDGIDKDNFAYSYSLVEGDALSDKIEKISYETKLVASSDGGSVIKSTSNYHTKGDVEIKEEHVKAGKEKASHLFKLVEDYLLANPNEYC |
Generate a protein sequence for a novel protein that integrates the following function keywords: Plant defense and hormone signaling protein, START-like domain superfamily, Bet v I/Major latex protein, Bet v I type allergen. The designed protein sequence is | [
{
"Beg": 1,
"End": 155,
"ID": "IPR000916",
"Name": "Bet v I/Major latex protein",
"Type": "Domain"
},
{
"Beg": 2,
"End": 158,
"ID": "IPR023393",
"Name": "START-like domain superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 3,
"End": 23,
"ID": "IPR0... | MGVFTYETEFTSVIPPPRLFKAFILDADNLIPKIAPQAVKCAEIVEGDGGVGTIKKITFGEGSQFGSVTHKIDGIDKENFVYSYSLVEGDALSDKIEKISYETKLVASSDGGSVIKSTSNYHTKGDVEIKEEHVKAGKEKASHLFKLVEDYLLANPNEYC |
Generate a protein sequence for a novel protein that integrates the following function keywords: Plant defense and hormone signaling protein, START-like domain superfamily, Bet v I/Major latex protein, Bet v I type allergen. The designed protein sequence is | [
{
"Beg": 1,
"End": 155,
"ID": "IPR000916",
"Name": "Bet v I/Major latex protein",
"Type": "Domain"
},
{
"Beg": 2,
"End": 158,
"ID": "IPR023393",
"Name": "START-like domain superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 3,
"End": 23,
"ID": "IPR0... | MGVFTYETEFTSVIPPPRLFKAFILDADNLIPKIAPQAVKCAEIIEGDGGVGTIKKITFGEGSQFGSVTHKIDGIDKDNFVYSYSLVEGDALSDKIEKISYETKLVASSDGGSIIKSTSNYHTKGDVEIKEEHVKAGKEKASHLFKLVEGYLLANPNEYC |
Generate a protein sequence for a novel protein that integrates the following function keywords: Plant defense and hormone signaling protein, START-like domain superfamily, Bet v I/Major latex protein, Bet v I type allergen. The designed protein sequence is | [
{
"Beg": 1,
"End": 154,
"ID": "IPR000916",
"Name": "Bet v I/Major latex protein",
"Type": "Domain"
},
{
"Beg": 2,
"End": 159,
"ID": "IPR023393",
"Name": "START-like domain superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 3,
"End": 23,
"ID": "IPR0... | MGVFTYETEFTSVIPPPRLYKAFVLDTDNLIPKIAPQAVKSTELVQGDGGVGTIKKIHLGEGSEYSYVKHQIDGLDKDNFVYNYSIIEGDAIGDKVEKISYEIKLVASPSGGSIIKSTSHYHCKGEVEIKEEHVKAGKERAAGLFKIIENYLLGNPDAYN |
Generate a protein sequence for a novel protein that integrates the following function keywords: Transcription factor GRAS. The designed protein sequence is | [
{
"Beg": 223,
"End": 588,
"ID": "IPR005202",
"Name": "Transcription factor GRAS",
"Type": "Family"
},
{
"Beg": 212,
"End": 588,
"ID": "IPR005202",
"Name": "Transcription factor GRAS",
"Type": "Family"
},
{
"Beg": 198,
"End": 582,
"ID": "IPR005202",
"Na... | MAYMCADSGNLMAIAQQVIKQKQQQEQQQQQSHHPQQQFLGLNPFSLNPWPSTTMSANPNLGYGLSGPAAFSDPFQSGPDTGDPPGFSFSNMEHQHSGGFRFPDFTGAGGEFDSDEWMDSLMNGGDSTDSSNLPSGCDAWQNNADFGIYPSDPFNTSPSRLTVGCSPPSDLNRVISDSLWADPSPQEIKPKTSPPQQPPPTAKNEVVVGSKEVVELSSSPVLKAFVECAQLVESKVDQAVKSLIKLKESVSENGDPGERVGFYFVQGLCRRVAVGELDDLKNFHQTTSEEFTLSYKALNDACPYSKFAHLTANQAILEAT... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Flavivridae NS3 helicase, C-terminal helical domain, Flaviviral glycoprotein E, central domain, subdomain 1, Flavivirus/Alphavirus glycoprotein, immunoglobulin-like domain superfamily, Flavivirus non-structural protein NS2A... | [
{
"Beg": 217,
"End": 290,
"ID": "IPR000069",
"Name": "Envelope glycoprotein M, flavivirus",
"Type": "Domain"
},
{
"Beg": 2772,
"End": 3222,
"ID": "IPR000208",
"Name": "RNA-directed RNA polymerase, fingers/palm subdomains, flavivirus",
"Type": "Domain"
},
{
"Beg": ... | MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKKRRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKVIYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGC... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Flavin monoamine oxidase and related enzymes, Amine oxidase, FAD/NAD(P)-binding domain superfamily. The designed protein sequence is | [
{
"Beg": 45,
"End": 482,
"ID": "IPR002937",
"Name": "Amine oxidase",
"Type": "Domain"
},
{
"Beg": 37,
"End": 483,
"ID": "IPR036188",
"Name": "FAD/NAD(P)-binding domain superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 34,
"End": 484,
"ID": "IPR036... | SCADDRNPLEECFQETDYEEFLEIARNGLKATSNPKHVVIVGAGMSGLSAAYVLAGAGHQVTVLEASERAGGRVRTYRNDKEGWYANLGPMRLPEKHRIVREYITKFGLQLNEFSQENENAWYFIKNIRKRVGEVKKDPGLLQYPVKPSEEGKSAGQLYEESLGKVVEELKRTNCSYILDKYDTYSTKEYLIKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDNIFGYEKRFNEIVDGMDKLPTSMYQAIEEKVRFNARVIKIQQNDNEVTVTYQTSENEMSPVTADYVIVCTTSRAARRITFEPPLPPKKAHALRS... |
Generate a protein sequence for a novel protein that integrates the following function keywords: HotDog domain superfamily, Post-transcriptional expression and antimicrobial biosynthesis protein. The designed protein sequence is | [
{
"Beg": 94,
"End": 221,
"ID": "IPR029069",
"Name": "HotDog domain superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 26,
"End": 223,
"ID": "IPR052061",
"Name": "Post-transcriptional expression and antimicrobial biosynthesis protein",
"Type": "Family"
}
] | MEVKKLEFIGPRVMPGGQKEMDYFCQVPEFQQRCQSGNAVVIPRRDQVADGRGSTGKLFSQTLNTADTIPHCIVMFEDTYTAQSSTQPWLPISTCSVFYQLGEGVCGFGNICHGGIQTTLLDDVMGVLGVLNARLQDGIIPSKVPGAYWPRNNPGMVDLTKSLFATQGIEVKFLRPLRTPQVIEVSAQLVDMDVSGGSFTVQCVIRDMKGKQYAVANANWVIHTPRPRSRL |
Generate a protein sequence for a novel protein that integrates the following function keywords: Condensation domain, Phosphopantetheine attachment site, ACP-like superfamily, AMP-binding, conserved site, AMP-binding enzyme, C-terminal domain superfamily, Phosphopantetheine binding ACP domain, Polyketide synthase-like,... | [
{
"Beg": 989,
"End": 1330,
"ID": "IPR000873",
"Name": "AMP-dependent synthetase/ligase domain",
"Type": "Domain"
},
{
"Beg": 2547,
"End": 2887,
"ID": "IPR000873",
"Name": "AMP-dependent synthetase/ligase domain",
"Type": "Domain"
},
{
"Beg": 4114,
"End": 4457,... | MDAPDIQAPSGSCRTTLGKVAADIFEMNVETLDWDMSFIQMGGDSILAIDFIVRCRDEGIWVDMMDLLTVDTLAELADSIDEQNGVTADVANSSDLNEHETHQENGENINATLPVADRPLRFASMEIAHVKDASLVSSALESLITRHSALRSVWSVSSTGEYTLTTKPTAMAYESQPFFLAEASEPTKMNDAFELLKNALRSDGAPPLGCLFISNNATTASSIIVLAADANLVDSLSMRILRTEFREFILGHALDAPPGFQFSNWVAAKCQSTTARPRTLQQPQRAMERAIATKLSSSTSSADSSSNEATITTFQITHST... |
Generate a protein sequence for a novel protein that integrates the following function keywords: AMP-dependent synthetase/ligase domain, AMP-binding enzyme, C-terminal domain superfamily, AMP-binding enzyme, C-terminal domain, ANL, N-terminal domain. The designed protein sequence is | [
{
"Beg": 51,
"End": 423,
"ID": "IPR000873",
"Name": "AMP-dependent synthetase/ligase domain",
"Type": "Domain"
},
{
"Beg": 480,
"End": 562,
"ID": "IPR025110",
"Name": "AMP-binding enzyme, C-terminal domain",
"Type": "Domain"
},
{
"Beg": 27,
"End": 466,
"ID... | MIFTQPSFVPALPSPLPLGETIGDFCMSERLAKVGNDAVEEQPIPFIDAAIDKSWTTDEINTRVAQLTRALATEWNIAPGEKWHKQVAVLASNCVSIFMDTLILTWAIHRLGGGCLMLQPTSSVEEMAAHIDHVPPFAMFVTLDLVTLGQETIQKSSQSADLPFYKFSKVYGPPAKNAPDTSNVKSLDALLEKSKDQAPIEKLLLAEGEGSKRVAYYCTTSGTGGFQRIVAITHENIIASILQAGLFTGITKEKSEIALVFTPFNHIYGLLTAHTLMWLGHSTVIHRGFNMLEVLMSIPKRRITTLYLVPPIINAMSRNA... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Sterol Desaturase and Related Enzymes, Fatty acid hydroxylase. The designed protein sequence is | [
{
"Beg": 189,
"End": 335,
"ID": "IPR006694",
"Name": "Fatty acid hydroxylase",
"Type": "Domain"
},
{
"Beg": 158,
"End": 338,
"ID": "IPR050307",
"Name": "Sterol Desaturase and Related Enzymes",
"Type": "Family"
}
] | MPSTTQTTVQSIDSIDSIPTTIKRRQNDKTKTPKTKPVSKIPICPKNSSIPRLDQPSQHKFILLQSLLPITVHQLTTLVLSISRYDDYVHPFLLRLCVIIGYGYAFRFLLRREGLAIRTLGKKLGYLDGDHHPRDKVPRDSTRLNWSLPLTVGSRTVMCVLVAYDPSQQPINYLASLKWWAWLAVYLSLYPIILDFYYYCVHRAWHEVPCLWRFHRRHHTIKRPSILFTAYADSEQELFDIVGTPLLTFFTLKALHLPMDFYTWWICIQYIAYTEVMGHSGLRIYTTPPISCSWLLQRFGVELVIEDHDLHHRQGYRQAR... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Gamma-carboxyglutamic acid-rich (GLA) domain superfamily, Osteocalcin, Gamma-carboxyglutamic acid-rich (GLA) domain. The designed protein sequence is | [
{
"Beg": 131,
"End": 163,
"ID": "IPR000294",
"Name": "Gamma-carboxyglutamic acid-rich (GLA) domain",
"Type": "Domain"
},
{
"Beg": 131,
"End": 164,
"ID": "IPR035972",
"Name": "Gamma-carboxyglutamic acid-rich (GLA) domain superfamily",
"Type": "Homologous_superfamily"
},
... | MKSLTLLTICAVLSVSLSMNDLALDVVLDPAPDPATEPAPAADSSASSSASSSSSSASDSSASASDSSDSDSSSASSSSSSSESASAEVTTEDPAAATEPEVVIMKRDLASVLLRRKRAAGQAAAAFTLTQVESLSEVCELNLACEHMAETAGIVAAYTAYYGPPPF |
Generate a protein sequence for a novel protein that integrates the following function keywords: Translation machinery associated TMA7. The designed protein sequence is | [
{
"Beg": 3,
"End": 64,
"ID": "IPR015157",
"Name": "Translation machinery associated TMA7",
"Type": "Family"
},
{
"Beg": 1,
"End": 64,
"ID": "IPR015157",
"Name": "Translation machinery associated TMA7",
"Type": "Family"
}
] | MSSHEGGKKKALKQPKKQAKEMDEEEKAFKQKQKEEQKKLEVLKAKVVGKGPLATGGIKKSGKK |
Generate a protein sequence for a novel protein that integrates the following function keywords: NUDIX hydrolase-like domain superfamily, NUDIX hydrolase domain, NUDIX hydrolase, conserved site, Diphosphoinositol polyphosphate phosphohydrolase-like, NUDIX domain. The designed protein sequence is | [
{
"Beg": 20,
"End": 143,
"ID": "IPR000086",
"Name": "NUDIX hydrolase domain",
"Type": "Domain"
},
{
"Beg": 18,
"End": 145,
"ID": "IPR000086",
"Name": "NUDIX hydrolase domain",
"Type": "Domain"
},
{
"Beg": 11,
"End": 147,
"ID": "IPR015797",
"Name": "NUD... | MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR |
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycoside hydrolase, family 7, Cellulose-binding domain superfamily, Glycoside hydrolase family 7, catalytic domain superfamily, Cellulose-binding domain, fungal, Concanavalin A-like lectin/glucanase domain superfamily. The... | [
{
"Beg": 482,
"End": 510,
"ID": "IPR000254",
"Name": "Cellulose-binding domain, fungal",
"Type": "Domain"
},
{
"Beg": 486,
"End": 513,
"ID": "IPR000254",
"Name": "Cellulose-binding domain, fungal",
"Type": "Domain"
},
{
"Beg": 478,
"End": 514,
"ID": "IPR00... | MYRKLAVISAFLATARAQSACTLQSETHPPLTWQKCSSGGTCTQQTGSVVIDANWRWTHATNSSTNCYDGNTWSSTLCPDNETCAKNCCLDGAAYASTYGVTTSGNSLSIGFVTQSAQKNVGARLYLMASDTTYQEFTLLGNEFSFDVDVSQLPCGLNGALYFVSMDADGGVSKYPTNTAGAKYGTGYCDSQCPRDLKFINGQANVEGWEPSSNNANTGIGGHGSCCSEMDIWEANSISEALTPHPCTTVGQEICEGDGCGGTYSDNRYGGTCDPDGCDWNPYRLGNTSFYGPGSSFTLDTTKKLTVVTQFETSGAINRY... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Alpha/Beta hydrolase fold, Cutinase, serine active site, Cutinase, monofunctional, Cutinase/acetylxylan esterase, Cutinase, aspartate and histidine active sites. The designed protein sequence is | [
{
"Beg": 78,
"End": 244,
"ID": "IPR000675",
"Name": "Cutinase/acetylxylan esterase",
"Type": "Family"
},
{
"Beg": 77,
"End": 247,
"ID": "IPR000675",
"Name": "Cutinase/acetylxylan esterase",
"Type": "Family"
},
{
"Beg": 99,
"End": 109,
"ID": "IPR011150",
... | MRSLAILTTLLAGHAFAYPKPAPQSVNRRDWPSINEFLSELAKVMPIGDTITAACDLISDGEDAAASLFGISETENDPCGDVTVLFARGTCDPGNVGVLVGPWFFDSLQTALGSRTLGVKGVPYPASVQDFLSGSVQNGINMANQIKSVLQSCPNTKLVLGGYSQGSMVVHNAASNLDAATMSKISAVVLFGDPYYGKPVANFDAAKTLVVCHDGDNICQGGDIILLPHLTYAEDADTAAAFVVPLVS |
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycoside hydrolase, family 5, conserved site, Glycoside hydrolase, family 5, Glycoside hydrolase superfamily, Cellulose-binding domain superfamily, Cellulose-binding domain, fungal. The designed protein sequence is | [
{
"Beg": 26,
"End": 53,
"ID": "IPR000254",
"Name": "Cellulose-binding domain, fungal",
"Type": "Domain"
},
{
"Beg": 29,
"End": 56,
"ID": "IPR000254",
"Name": "Cellulose-binding domain, fungal",
"Type": "Domain"
},
{
"Beg": 21,
"End": 57,
"ID": "IPR000254",... | MNKSVAPLLLAASILYGGAAAQQTVWGQCGGIGWSGPTNCAPGSACSTLNPYYAQCIPGATTITTSTRPPSGPTTTTRATSTSSSTPPTSSGVRFAGVNIAGFDFGCTTDGTCVTSKVYPPLKNFTGSNNYPDGIGQMQHFVNDDGMTIFRLPVGWQYLVNNNLGGNLDSTSISKYDQLVQGCLSLGAYCIVDIHNYARWNGGIIGQGGPTNAQFTSLWSQLASKYASQSRVWFGIMNEPHDVNINTWAATVQEVVTAIRNAGATSQFISLPGNDWQSAGAFISDGSAAALSQVTNPDGSTTNLIFDVHKYLDSDNSGTH... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Cellulose-binding domain superfamily, 1, 4-beta cellobiohydrolase superfamily, 1, 4-beta cellobiohydrolase, Cellulose-binding domain, fungal, Glycoside hydrolase, family 6, conserved site. The designed protein sequence is | [
{
"Beg": 31,
"End": 58,
"ID": "IPR000254",
"Name": "Cellulose-binding domain, fungal",
"Type": "Domain"
},
{
"Beg": 34,
"End": 61,
"ID": "IPR000254",
"Name": "Cellulose-binding domain, fungal",
"Type": "Domain"
},
{
"Beg": 26,
"End": 62,
"ID": "IPR000254",... | MIVGILTTLATLATLAASVPLEERQACSSVWGQCGGQNWSGPTCCASGSTCVYSNDYYSQCLPGAASSSSSTRAASTTSRVSPTTSRSSSATPPPGSTTTRVPPVGSGTATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRAL... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycoside hydrolase family 10 domain, Glycoside hydrolase superfamily, Glycoside hydrolase family 10. The designed protein sequence is | [
{
"Beg": 50,
"End": 343,
"ID": "IPR001000",
"Name": "Glycoside hydrolase family 10 domain",
"Type": "Domain"
},
{
"Beg": 125,
"End": 137,
"ID": "IPR001000",
"Name": "Glycoside hydrolase family 10 domain",
"Type": "Domain"
},
{
"Beg": 168,
"End": 179,
"ID":... | MKANVILCLLAPLVAALPTETIHLDPELAALRANLTERTADLWDRQASQSIDQLIKRKGKLYFGTATDRGLLQREKNAAIIQADLGQVTPENSMKWQSLENNQGQLNWGDADYLVNFAQQNGKSIRGHTLIWHSQLPAWVNNINNADTLRQVIRTHVSTVVGRYKGKIRAWDVVNEIFNEDGTLRSSVFSRLLGEEFVSIAFRAARDADPSARLYINDYNLDRANYGKVNGLKTYVSKWISQGVPIDGIGSQSHLSGGGGSGTLGALQQLATVPVTELAITELDIQGAPTTDYTQVVQACLSVSKCVGITVWGISDKDSW... |
Generate a protein sequence for a novel protein that integrates the following function keywords: GFO/IDH/MocA-like oxidoreductase domain, NAD(P)-binding domain superfamily, Gfo/Idh/MocA domain-containing protein, Gfo/Idh/MocA-like oxidoreductase, N-terminal. The designed protein sequence is | [
{
"Beg": 11,
"End": 137,
"ID": "IPR000683",
"Name": "Gfo/Idh/MocA-like oxidoreductase, N-terminal",
"Type": "Domain"
},
{
"Beg": 8,
"End": 166,
"ID": "IPR036291",
"Name": "NAD(P)-binding domain superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 3,
"End... | MASGNPYTLKWGIMATGGIAETFCKDLLCNPAIRGADDVRHEIVAVASSSSSKRAEEFLQRIDGAFDAKTYGSYPELVADPNVDIVYVATPHSHHFQNTMLALEAGKNVLCEKAFTVTAAQARKLVETAKAKKLFLMEAVWTRYFPLSIKIRELIAAGEIGTVFRTIADLSINANSEQGQALKFADSHRMVNPDLAGGATLDLGVYPLTWVFQTLYHLQPEEDKEAPTVVASSNKYTTGADENTAIICSFPRHNSIGIASTTMRADTDPEKDTIPAVRIQGSKGEIQVFFPTYRPLKYKVVKTNGEAQTVDCPIPGDPAR... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycoside hydrolase, family 7, Cellulose-binding domain superfamily, Glycoside hydrolase family 7, catalytic domain superfamily, Cellulose-binding domain, fungal, Concanavalin A-like lectin/glucanase domain superfamily. The... | [
{
"Beg": 427,
"End": 455,
"ID": "IPR000254",
"Name": "Cellulose-binding domain, fungal",
"Type": "Domain"
},
{
"Beg": 431,
"End": 458,
"ID": "IPR000254",
"Name": "Cellulose-binding domain, fungal",
"Type": "Domain"
},
{
"Beg": 423,
"End": 459,
"ID": "IPR00... | MAPSVTLPLTTAILAIARLVAAQQPGTSTPEVHPKLTTYKCTKSGGCVAQDTSVVLDWNYRWMHDANYNSCTVNGGVNTTLCPDEATCGKNCFIEGVDYAASGVTTSGSSLTMNQYMPSSSGGYSSVSPRLYLLDSDGEYVMLKLNGQELSFDVDLSALPCGENGSLYLSQMDENGGANQYNTAGANYGSGYCDAQCPVQTWRNGTLNTSHQGFCCNEMDILEGNSRANALTPHSCTATACDSAGCGFNPYGSGYKSYYGPGDTVDTSKTFTIITQFNTDNGSPSGNLVSITRKYQQNGVDIPSAQPGGDTISSCPSASA... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Olfactory receptor, insect. The designed protein sequence is | [
{
"Beg": 69,
"End": 466,
"ID": "IPR004117",
"Name": "Olfactory receptor, insect",
"Type": "Family"
},
{
"Beg": 21,
"End": 477,
"ID": "IPR004117",
"Name": "Olfactory receptor, insect",
"Type": "Family"
}
] | MMKMKQQGLVADLLPNIRVMKTFGHFVFNYYNDNSSKYLHKVYCCVNLFMLLLQFGLCAVNLIVESADVDDLTANTITLLFFTHSIVKICYFAIRSKYFYRTWAIWNNPNSHPLFAESNARYHAIALKKMRLLLFLVGGTTMLAAVAWTVLTFFEHPIRKIVDPVTNETEIIELPQLLIRSFYPFDAGKGITHVLVLVYQFYWVLFMLIDANSLDVLFCSWLLFACEQLQHLKQIMKPLMELSATLDTVVPNSSELFKAGSADHLRDGDNPPPPPPPQSDNMLDLDLRNIYSNRQDFTATFRPTAGMTFNGGVGPNGLTK... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycyl Radical Enzyme, Trans-4-hydroxy-L-proline dehydratase, Pyruvate formate lyase domain, Glycine radical domain. The designed protein sequence is | [
{
"Beg": 668,
"End": 771,
"ID": "IPR001150",
"Name": "Glycine radical domain",
"Type": "Domain"
},
{
"Beg": 670,
"End": 789,
"ID": "IPR001150",
"Name": "Glycine radical domain",
"Type": "Domain"
},
{
"Beg": 7,
"End": 652,
"ID": "IPR004184",
"Name": "Py... | MARGTFERTKKLREESINAEPHISIERAVLMTEAYKKYEGSVEIPVLRALSFKHYIENRTLSINDGELIVGEKGDSPNGAPTYPEICCHTMEDLEVMHNRDIINFSVSEEARKIHKEEIIPFWKKRQTRDKIINAMTPEWLAAYEAGMFTEFMEQRAPGHTVCGDTIYKKGFLDLKKDIEARLKELDFLNDLDAYNKKADLEAMAIACDAMVILGKRYAEKARQMAEEETDEAKKKDLLLIAETCDVVPAHKPETYHQAIQMYWFVHIGVTTELNIWDAFTPGRLDQHLNPFYERDVENGILDRDRAQELLECLWVKFNN... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Peptidase S8, pro-domain superfamily, Galactose-binding-like domain superfamily, Peptidase S8/S53 domain, Peptidase S8, subtilisin, Ser-active site, Peptidase S8, subtilisin-related, Peptidase S8, subtilisin, Asp-active sit... | [
{
"Beg": 192,
"End": 474,
"ID": "IPR000209",
"Name": "Peptidase S8/S53 domain",
"Type": "Domain"
},
{
"Beg": 535,
"End": 620,
"ID": "IPR002884",
"Name": "P domain",
"Type": "Domain"
},
{
"Beg": 490,
"End": 628,
"ID": "IPR002884",
"Name": "P domain",
... | MYWQLVRILVLFDCLQKILAIEHDSICIADVDDACPEPSHTVMRLRERNDKKAHLIAKQHGLEIRGQPFLDGKSYFVTHISKQRSRRRKREIISRLQEHPDILSIEEQRPRVRRKRDFLYPDIAHELAGSSTNIRHTGLISNTEPRIDFIQHDAPVLPFPDPLYKEQWYLNNGAQGGFDMNVQAAWLLGYAGRNISVSILDDGIQRDHPDLAANYDPLASTDINGHDDDPTPQDDGDNKHGTRCAGEVASIAGNVYCGVGVAFHAKIGGVRMLDGPVSDSVEAASLSLNRHHIDIYSASWGPEDDGRTFDGPGPLAREAF... |
Generate a protein sequence for a novel protein that integrates the following function keywords: AAA+ ATPase domain, ATP-binding cassette transporter, PDR-like subfamily G, domain 1, ATP-binding cassette transporter, PDR-like subfamily G, domain 2, ABC transporter-like, conserved site, P-loop containing nucleoside trip... | [
{
"Beg": 198,
"End": 358,
"ID": "IPR003439",
"Name": "ABC transporter-like, ATP-binding domain",
"Type": "Domain"
},
{
"Beg": 910,
"End": 1061,
"ID": "IPR003439",
"Name": "ABC transporter-like, ATP-binding domain",
"Type": "Domain"
},
{
"Beg": 167,
"End": 432,... | MASQPPQPPSGQPDTQYEEYQSEVITETTNRPTPAADVYEITPTNDVMDDRYEHEHDDYESGAMYETVRTWSPQSRPELVRIASVFSRIDSHPDVAPTTEDGGQLNRRDTLAGVKIGDPVLDPTKPEFDFYKWARMFTHVMEKEGIKRNRTGVMFRNLTVLGSGSAVQYQDTFLSPFAAPFRPGELCGKGRNPEKVILHDFNGAIREGELLMVLGRPGSGCSTFLKAICGELHGLQKKKESIIHYNGVSQHTFKKELRGEAVYSAEDEHHFPHLTVGQTLEFAAAARTPSKRVLGLSRKDFSTHLARVMMSVFGLSHTYN... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Knottin, scorpion toxin-like superfamily, Defensin, invertebrate/fungal. The designed protein sequence is | [
{
"Beg": 48,
"End": 82,
"ID": "IPR001542",
"Name": "Defensin, invertebrate/fungal",
"Type": "Domain"
},
{
"Beg": 48,
"End": 84,
"ID": "IPR001542",
"Name": "Defensin, invertebrate/fungal",
"Type": "Domain"
},
{
"Beg": 54,
"End": 84,
"ID": "IPR036574",
"... | MQFTKLATVLIVSLMGSAAIAAPSVDNAPAVAAEEVAAAPAENLEKRGFGCPLNERECHSHCQSIGRKFGYCGGTLRLTCICGKE |
Generate a protein sequence for a novel protein that integrates the following function keywords: AAA+ ATPase domain, ABC transporter type 1, transmembrane domain superfamily, ABC transporter type 1, transmembrane domain, P-loop containing nucleoside triphosphate hydrolase, ABC transporter-like, ATP-binding domain, Type... | [
{
"Beg": 441,
"End": 598,
"ID": "IPR003439",
"Name": "ABC transporter-like, ATP-binding domain",
"Type": "Domain"
},
{
"Beg": 1104,
"End": 1255,
"ID": "IPR003439",
"Name": "ABC transporter-like, ATP-binding domain",
"Type": "Domain"
},
{
"Beg": 422,
"End": 667... | MVEVSEKPNTQDDGVSKQENRNPASSSSSTSDKEKVAKKGNSDATKSSTPEDLDAQLAHLPEHEREILKQQLFIPDAKATYGTLFRYATRNDMIFLAIVSLASIAAGAALPLFTVLFGSLAGTFRDIALHRITYDEFNSILTRNSLYFVYLGIAQFILLYVSTVGFIYVGEHITQKIRAKYLHAILRQNIGFFDKLGAGEVTTRITADTNLIQDGISEKVGLTLTALSTFFSAFIIGYVRYWKLALICSSTIVAMILVMGGISRFVVKSGRMTLVSYGEGGTVAEEVISSIRNATAFGTQEKLARQYEVHLKEARKWGRR... |
Generate a protein sequence for a novel protein that integrates the following function keywords: AAA+ ATPase domain, ABC transporter type 1, transmembrane domain superfamily, ABC transporter type 1, transmembrane domain, P-loop containing nucleoside triphosphate hydrolase, ABC transporter-like, ATP-binding domain, Type... | [
{
"Beg": 421,
"End": 613,
"ID": "IPR003439",
"Name": "ABC transporter-like, ATP-binding domain",
"Type": "Domain"
},
{
"Beg": 1153,
"End": 1305,
"ID": "IPR003439",
"Name": "ABC transporter-like, ATP-binding domain",
"Type": "Domain"
},
{
"Beg": 403,
"End": 682... | MAVEEKNSPTGAAMTNTGILVPSSQQSLPEWWTKTQKFFSRENTITPTFGYFRLLFGTQPGKTDIALIVIGTIAGIGAGIPFPLLGILFGELVDDLNSSTCSTTQAPPGGYQAAITTKVLQVIYVSILNFVCMYIHTGCWSMVGERLVRRLRTKYFHSLLRQEIAFTDTLPSGDVTSRLVSDIEVIQAGTSEKVGLFIGTISYFVAAYIVAFLKVATIAAMLMSVVPIYFLMAFGGGHYIKKYSGRISTHINAATSIVSSSLSHMSIVHAFNANARLEALFAQHLVSARMDALKKAITHSIQFGMLYFVAYASNALAFWQ... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Spider toxin CSTX, Knottin scaffold, Spider toxin CSTX, Knottin scaffold conserved site. The designed protein sequence is | [
{
"Beg": 51,
"End": 77,
"ID": "IPR011142",
"Name": "Spider toxin CSTX, Knottin scaffold conserved site",
"Type": "Conserved_site"
},
{
"Beg": 115,
"End": 141,
"ID": "IPR011142",
"Name": "Spider toxin CSTX, Knottin scaffold conserved site",
"Type": "Conserved_site"
},
... | MKFSLFFGVLFLAILHSCLSESEKDLTDEDHFRSSDSFLSEIQEESRGKKCIERNKECTNDRHGCCRGKIFKDKCECVGSGGKERCVCKQKKWAKIIESYIGDIPTLPKPEDDKCVPKHEDCSERKNDCCKSGLFTLKCKCYDMQDDEDGKKTELCGCVQPFEHKAIEQALRFGKWMVG |
Generate a protein sequence for a novel protein that integrates the following function keywords: NAD-dependent epimerase/dehydratase, NAD(P)-dependent dehydratase-like, NAD(P)-binding domain superfamily. The designed protein sequence is | [
{
"Beg": 9,
"End": 241,
"ID": "IPR001509",
"Name": "NAD-dependent epimerase/dehydratase",
"Type": "Domain"
},
{
"Beg": 2,
"End": 313,
"ID": "IPR036291",
"Name": "NAD(P)-binding domain superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 8,
"End": 305,
... | MRSVSGQVVCVTGAGGFIASWLVKILLEKGYTVRGTVRNPDDPKNGHLRELEGAKERLTLCKADLLDYQSLREAINGCDGVFHTASPVTDDPEQMVEPAVIGTKNVINAAAEANVRRVVFTSSIGAVYMDPNRDPETVVDETCWSDPDFCKNTKNWYCYGKMVAEQAAWEEAKEKGVDLVVINPVLVQGPLLQTTVNASVLHILKYLTGSAKTYANSVQAYVDVKDVALAHILLYETPEASGRYLCAESVLHRGDVVEILSKFFPEYPIPTKCSDVTKPRVKPYKFSNQKLKDLGLEFTPVKQCLYETVKSLQEKGHLPI... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Knottin, scorpion toxin-like superfamily. The designed protein sequence is | [
{
"Beg": 24,
"End": 54,
"ID": "IPR036574",
"Name": "Knottin, scorpion toxin-like superfamily",
"Type": "Homologous_superfamily"
}
] | MKIFFAILLILAVCSMAIWTVNGTPFAIRCKTDSDCSYKCPGNPPCRNGFCKCT |
Generate a protein sequence for a novel protein that integrates the following function keywords: Scorpion short chain toxin, potassium channel inhibitor, Knottin, scorpion toxin-like superfamily. The designed protein sequence is | [
{
"Beg": 32,
"End": 62,
"ID": "IPR001947",
"Name": "Scorpion short chain toxin, potassium channel inhibitor",
"Type": "Family"
},
{
"Beg": 25,
"End": 62,
"ID": "IPR036574",
"Name": "Knottin, scorpion toxin-like superfamily",
"Type": "Homologous_superfamily"
},
{
"... | MKFLFLTLVLLYFTAILVFIVFPSYAQIQTNASCTTSTHCVEPCRKRCLLIHKCINDKCTCYPRINICEKKNN |
Generate a protein sequence for a novel protein that integrates the following function keywords: Knottin, scorpion toxin-like superfamily. The designed protein sequence is | [
{
"Beg": 25,
"End": 56,
"ID": "IPR036574",
"Name": "Knottin, scorpion toxin-like superfamily",
"Type": "Homologous_superfamily"
}
] | MSGLSVFILIALVLSVIIDVLNNSKVEAACKENCRQYCQAKGARNGKCINSNCKCYY |
Generate a protein sequence for a novel protein that integrates the following function keywords: Long chain scorpion toxin, cysteine-stabilized alpha/beta domain. The designed protein sequence is | [
{
"Beg": 38,
"End": 86,
"ID": "IPR029237",
"Name": "Long chain scorpion toxin, cysteine-stabilized alpha/beta domain",
"Type": "Domain"
},
{
"Beg": 54,
"End": 91,
"ID": "IPR029237",
"Name": "Long chain scorpion toxin, cysteine-stabilized alpha/beta domain",
"Type": "Domai... | MQRNLVVLLFLGMVALSSCGLREKHFQKLVKYAVPEGTLRTIIQTAVHKLGKTQFGCPAYQGYCDDHCQDIKKQEGFCHGFKCKCGIPMGF |
Generate a protein sequence for a novel protein that integrates the following function keywords: Pyruvate phosphate dikinase, AMP/ATP-binding, Phosphoenolpyruvate Utilizing Enzyme, PEP-utilising enzyme, mobile domain, ATP-grasp fold, subdomain 1, Phosphohistidine domain superfamily. The designed protein sequence is | [
{
"Beg": 19,
"End": 316,
"ID": "IPR002192",
"Name": "Pyruvate phosphate dikinase, AMP/ATP-binding",
"Type": "Domain"
},
{
"Beg": 789,
"End": 859,
"ID": "IPR008279",
"Name": "PEP-utilising enzyme, mobile domain",
"Type": "Domain"
},
{
"Beg": 1,
"End": 185,
... | MSGRLVVDLQDVDAAGLAEVGGKGAHLGELSRIDGVRVPSGFCVTTHAFRRIMAEAPESGELLDRLSRVDEGDQEAVRSLAARLRQVVGATPLPDEVAAAVTGALARHGERSAYAVRSSATAEDLPTASFAGQQDTYLNVVGTEEILRHVSRCWASLFTERAVTYRGRQGVDHRTVHMGVVVQRMVVPRASGILFTADPVTGDRRTATVDAGFGLGEALVSGLVDPDVLTVRHGEVVARTIAAKRRALHAVQGGGTRETPIEERRQREPVLTDDQAVELVALGRRIEAHFGSPQDIEWCLDDDGFHIVQSRPITTLFPVP... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Vanillate O-demethylase oxygenase-like, C-terminal catalytic domain, Rieske [2Fe-2S] iron-sulphur domain superfamily, Cholesterol 7-desaturase, Rieske [2Fe-2S] iron-sulphur domain. The designed protein sequence is | [
{
"Beg": 7,
"End": 86,
"ID": "IPR017941",
"Name": "Rieske [2Fe-2S] iron-sulphur domain",
"Type": "Domain"
},
{
"Beg": 7,
"End": 108,
"ID": "IPR017941",
"Name": "Rieske [2Fe-2S] iron-sulphur domain",
"Type": "Domain"
},
{
"Beg": 1,
"End": 123,
"ID": "IPR036... | MFLQNAWYAVAWCDEVTDGIVTRKVLGRELALFRDGEGQPRAILNRCPHRFAPLSLGKRIGDAIQCPYHGLHFGPDGRCVHNPHGDGVVPDVATPTFPARERHKLIWAWMGDPALATDDIAGGEYGYLDDVELDLLPRGHLHLDCDYRLVIDNLMDPAHVAVLHDSALASEALIRAVPRVWREEDVIRVESWAPDSKPSFLFGAWLGNHDDPVDHWVASRWQAAGLLSVEGGVVAVGGDREDGLRVRGAHMITPETETSAHYFWAVVRNFREDDAEQSEQIRATTAAIFTGEDKWMLEAIERSMDGEEFWSLRPAILGTD... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Flavin-dependent aromatic-ring hydroxylase, FAD-binding domain, FAD/NAD(P)-binding domain superfamily. The designed protein sequence is | [
{
"Beg": 6,
"End": 316,
"ID": "IPR002938",
"Name": "FAD-binding domain",
"Type": "Domain"
},
{
"Beg": 9,
"End": 342,
"ID": "IPR036188",
"Name": "FAD/NAD(P)-binding domain superfamily",
"Type": "Homologous_superfamily"
},
{
"Beg": 5,
"End": 356,
"ID": "IPR0... | MTKHIKILVIGVGVAGPAVAYWLKRFGFSPVLIEKSAAVRKGGQALDIRGIATHIAKEMGIYDQICNMRTQIKCGRYVDVKGNVLHEEQGETFGFRQDDEVEILRGDLVEILMKAIADIPCEFKQSVIKIEQNEDSVTVTYKDGRVENYDLVIAADGIHSATRGMVFSKNEYQLINLGSYVSAFTIPNYLGLDHMELLCESNHKLVTLQSDSQADKAMAGFMFRSKHVLEDIRDEQEQKHFLHASFQNFGWETQNILNRMPESDDFYFDAITQIKMKSWTKGRIALIGDAAYCPSPLSGQGNNLAFVGAYILAGELKKAD... |
Generate a protein sequence for a novel protein that integrates the following function keywords: Chloroquine-resistance transporter-like. The designed protein sequence is | [
{
"Beg": 357,
"End": 688,
"ID": "IPR013936",
"Name": "Chloroquine-resistance transporter-like",
"Type": "Family"
},
{
"Beg": 349,
"End": 696,
"ID": "IPR013936",
"Name": "Chloroquine-resistance transporter-like",
"Type": "Family"
}
] | MPPAHHGSGGRRRPGRGNKGKRDTEAGMTASPDPGYMRPETHAAPSQQTDVRSPASAREHRNADVGVAAPDALTPNAGEQKEVEGVAKVNVAVSSDQPPDWAPSQSDLPPSLSPTTASRPATSSRSPRARSRHSPVASSSAFSSPAPSASALTSASGVPEAPLAAPELKHTLAADEGNPEPRLEGPVERLHARQENPLTDSSDGSYILLEEGESQRACLDRKNRHLRQTTPPGVWTTADLASQNSHSASFASGFRRALLPSGGSGDHDEQASDCRASLRGMQRPCFGSPSTDTRMGAAEGLPLASRRRRQHWRRELRAFG... |
Generate a protein sequence for a novel protein that integrates the following function keywords: HphA, C-terminal domain, Outer membrane protein/outer membrane enzyme PagP, beta-barrel, Slam-dependent hemophilin, C-terminal domain, HphA, N-terminal heme-binding domain. The designed protein sequence is | [
{
"Beg": 111,
"End": 262,
"ID": "IPR011250",
"Name": "Outer membrane protein/outer membrane enzyme PagP, beta-barrel",
"Type": "Homologous_superfamily"
},
{
"Beg": 21,
"End": 133,
"ID": "IPR054535",
"Name": "HphA, N-terminal heme-binding domain",
"Type": "Domain"
},
{... | MKISQLFLGLVACSTAFAYAGIDGISSNESNIKIGAAANASHPGGVAAVSVQAAGAPYNAFTGFSSLKGLAQAFAAQGTSNTNVTVGSKTFNISHIPVSAMPPSHSALGNFNFGQVGTQEVYFGEWWKAGDTPASASHTVYYAGDNTNTTVPTAGTATYTVAGINGSASNLLSGTFTANYGAGTLEGTLTGTGTAVSSLSLDGVAFNPGTAAFAGLATANGTAGVDNSGVVQGQFFGANASALAGIAQFDNVSYNTAFGGAKN |
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycosyl transferase, family 1, Sucrose synthase, N-terminal, Sucrose synthase, plant/cyanobacteria, Sucrose synthase, EPBD domain, Sucrose synthase, first GT-B domain. The designed protein sequence is | [
{
"Beg": 253,
"End": 542,
"ID": "IPR000368",
"Name": "Sucrose synthase, first GT-B domain",
"Type": "Domain"
},
{
"Beg": 550,
"End": 722,
"ID": "IPR001296",
"Name": "Glycosyl transferase, family 1",
"Type": "Domain"
},
{
"Beg": 56,
"End": 792,
"ID": "IPR01... | MIEALRQQLLDDPRSWYAFLRHLVASQRDSWLYTDLQRACADFREQLPEGYAEGIGPLEDFVAHTQEVIFRDPWMVFAWRPRPGRWIYVRIHREQLALEELSTDAYLQAKEGIVGLGAEGEAVLTVDFRDFRPVSRRLRDESTIGDGLTHLNRRLAGRIFSDLAAGRSQILEFLSLHRLDGQNLMLSNGNTDFDSLRQTVQYLGTLPRETPWAEIREDMRRRGFAPGWGNTAGRVRETMRLLMDLLDSPSPAALESFLDRIPMISRILIVSIHGWFAQDKVLGRPDTGGQVVYILDQARALEREMRNRLRQQGVDVEPRI... |
End of preview. Expand in Data Studio
Training set for Keyword-Guided task of Denovo Protein Design from Function
- SwissInPro-w.json: SwissInPro comprises a total of 554K proteins from UniProt/Swiss-Prot and 5M keywords extracted using InterProScan, and used for training of Keyword-Guided tesk.
- SwissInPro-wo.json: Exclude keywords in SwissInPro-w.json with the type "Family" or "Homologous_superfamily".
- Downloads last month
- 3