Instruction
stringlengths
135
4.21k
Keywords
listlengths
1
1.73k
Sequence
stringlengths
8
35.2k
Generate a protein sequence for a novel protein that integrates the following function keywords: Toll/interleukin-1 receptor homology (TIR) domain superfamily, Toll/interleukin-1 receptor homology (TIR) domain. The designed protein sequence is
[ { "Beg": 138, "End": 231, "ID": "IPR000157", "Name": "Toll/interleukin-1 receptor homology (TIR) domain", "Type": "Domain" }, { "Beg": 133, "End": 266, "ID": "IPR000157", "Name": "Toll/interleukin-1 receptor homology (TIR) domain", "Type": "Domain" }, { "Beg": 134...
MSLEQKKGADIISKILQIQNSIGKTTSPSTLKTKLSEISRKEQENARIQSKLSDLQKKKIDIDNKLLKEKQNLIKEEILERKKLEVLTKKQQKDEIEHQKKLKREIDAIKASTQYITDVSISSYNNTIPETEPEYDLFISHASEDKEDFVRPLAETLQQLGVNVWYDEFTLKVGDSLRQKIDSGLRNSKYGTVVLSTDFIKKDWTNYELDGLVAREMNGHKMILPIWHKITKNDVLDYSPNLADKVALNTSVNSIEEIAHQLADVILNR
Generate a protein sequence for a novel protein that integrates the following function keywords: FAD dependent oxidoreductase, FAD/NAD(P)-binding domain superfamily. The designed protein sequence is
[ { "Beg": 6, "End": 374, "ID": "IPR006076", "Name": "FAD dependent oxidoreductase", "Type": "Domain" }, { "Beg": 6, "End": 370, "ID": "IPR036188", "Name": "FAD/NAD(P)-binding domain superfamily", "Type": "Homologous_superfamily" }, { "Beg": 6, "End": 380, "...
MESIEAVVIGAGVVGLACARELARRGFETVILERHGAFGTETSARNSEVIHAGLYYPTDSLKARLCVAGRQQLYAFCATHAISHQRCGKLVVATSPAQESRLAALQKQGEANGVDDLQRLSAAEARALEPGLACTAALLSPSTGIVDSHGLMLALLGDAETAGAALALHSPLLRGSLDANTPGIVLESGGADGLRFKARRVINAAGLWAPQVAASLAGFPRTLIPANFHAKGSYYALTGRTPFSRLVYPLPEAGGLGVHLTLDLGGQARFGPDVEWLPDPTPGQPIDEPDYRVDPARADAFYAEIRRYWPALPDAALTPA...
Generate a protein sequence for a novel protein that integrates the following function keywords: Short-chain dehydrogenase/reductase SDR, NAD(P)-binding domain superfamily, Short-chain dehydrogenase/reductase, conserved site. The designed protein sequence is
[ { "Beg": 4, "End": 189, "ID": "IPR002347", "Name": "Short-chain dehydrogenase/reductase SDR", "Type": "Family" }, { "Beg": 75, "End": 86, "ID": "IPR002347", "Name": "Short-chain dehydrogenase/reductase SDR", "Type": "Family" }, { "Beg": 127, "End": 135, "I...
MSTKFALVTGCGQGGIGEALITEYARRGIHAIATVLPAEPSDHLARAGITFFPLDVTNEESVLELKARVQKLTGGRLDVLVNCAGIAYTMTAIDTDVAAVQRMFNVNVFGPMRMVHHFHDMIIKATGAIVNIGSIGGVVPYLYGSSYNATKAALQHWSNTLRVEMAPFDVRVITVISGEVATNILKNDAHRRLPEGSYYSPLAENFRQHVTRTPPRTTDRFQYAANVVAESLRSSPSAWFWYGSQSTLIRFLDMFCWRTVWDSLFWRMFDLGKLKEAHSSKAKKQV
Generate a protein sequence for a novel protein that integrates the following function keywords: Zn(2)-C6 fungal-type DNA-binding domain superfamily, Oleate Activated Transcription Factor 3, Zn(2)Cys(6) fungal-type DNA-binding domain. The designed protein sequence is
[ { "Beg": 11, "End": 45, "ID": "IPR001138", "Name": "Zn(2)Cys(6) fungal-type DNA-binding domain", "Type": "Domain" }, { "Beg": 11, "End": 41, "ID": "IPR001138", "Name": "Zn(2)Cys(6) fungal-type DNA-binding domain", "Type": "Domain" }, { "Beg": 6, "End": 50, ...
MDGKTYKLRASCNACNESKVRCSQTKPTCARCERNKTTCVYGLSRRTHKDAPPISLSHSHSHSHSGSQPHSHSGSRRSSVHIPNATATANATTTANYTSTTTPFMPLHENSMTSYPPQPSVDQFFAQQQPHHQQPSTAGPGPGILSPANLDLPSFMTPLPTPNEDHTNSLFSSFGNFAAGVGGVNGSVNNILTPLTGSPGTGTSASTSTDMFQQPQVQECTCHAGVMEQMASMSQPSRNEERRLSLDVQLSQLKRCIIASEASMGCGHHGNGDSEPINIISVAMLIGRIIDEFELMLNERIGRGTTMPERERSLSLDEAT...
Generate a protein sequence for a novel protein that integrates the following function keywords: Aromatic prenyltransferase, DMATS-type, Aromatic prenyltransferase DMATS-type, fungi, Aromatic prenyltransferase. The designed protein sequence is
[ { "Beg": 2, "End": 429, "ID": "IPR012148", "Name": "Aromatic prenyltransferase DMATS-type, fungi", "Type": "Family" }, { "Beg": 22, "End": 381, "ID": "IPR017795", "Name": "Aromatic prenyltransferase, DMATS-type", "Type": "Family" }, { "Beg": 5, "End": 423, ...
MALQTTNTWETLAQLLPSRNHDQDFWWKVTGRQLAVLLEAAGYPIERQYNTLLFHYHWAIPYLGPAPASGVAKWPSQLSVDGSPIEYSWKWNTKSKAPDVRYTMEPMSEFTGTKLDPLNQRAFRELLHKLSQFVPDVDLAPTDYFMSTLFDHDRSVLMKAVDDGVPLQFSSTALAFEFLDKGLLLKTYYAPRKLETGHFVLKDWDTAIRGYYPESKALDIVYEFLKTSPEGELMNPYHLAVDNVKDGRLKFYFQSPHRTFTSVREILTIGGRVQREGLEEQLLSLRDLLNALTGQSPDFPEDGEPPIVEEDVTADLDTDG...
Generate a protein sequence for a novel protein that integrates the following function keywords: Polyketide synthase, beta-ketoacyl synthase domain, ACP-like superfamily, GroES-like superfamily, Alcohol dehydrogenase-like, N-terminal, Acyl transferase domain superfamily, Polyketide synthase, C-terminal extension, Beta-...
[ { "Beg": 534, "End": 845, "ID": "IPR001227", "Name": "Acyl transferase domain superfamily", "Type": "Homologous_superfamily" }, { "Beg": 2320, "End": 2398, "ID": "IPR009081", "Name": "Phosphopantetheine binding ACP domain", "Type": "Domain" }, { "Beg": 1677, "...
MNDDPPCIVGMACRLPGDVRSPSQLWDLVINQKTGQGPTPPIRYNVDGYYHPDGNRSGGINVPGGYFINEDIRQFDNGFFGINNLEATYMDPQQRKLLEVVFECFESTGASMKSMSGSNTGVYVGNFSVDYQPMQTRDADYLHRYTSTGSGATIMSNRISHVFNLHGPSFTLDTACSSSVYALHQALTAIKVGDCESAVVASANLIMSPELHIGAAKSGVLSPTGTCHTFDASADGYGRAEGVNAIYVKRLSAALRDGNQIRAIVRGSAVNANGRTPGIALPSGNLQEAVMRKAYQNAGLDFAETDYVECHGTGTPVGDP...
Generate a protein sequence for a novel protein that integrates the following function keywords: Short-chain dehydrogenase/reductase SDR, NAD(P)-binding domain superfamily. The designed protein sequence is
[ { "Beg": 40, "End": 184, "ID": "IPR002347", "Name": "Short-chain dehydrogenase/reductase SDR", "Type": "Family" }, { "Beg": 41, "End": 58, "ID": "IPR002347", "Name": "Short-chain dehydrogenase/reductase SDR", "Type": "Family" }, { "Beg": 118, "End": 129, "...
MAVTFDISPEKEAGVLRLFHSQLFVTPPPLTRRDVDLSGKTAIVTGANGGLGLETAHQLLDLGCKVILAVRRVERGEAARQKLLEGRDAQATEIEVWPLDLSSYESVVGFAERAKTLSRLDIAILNAGLYKVNQTMTASTGYEESIHVNYLANALLITLLAPIFKNKKTGNTPGRIVLVSSDLAAWAKFKERKSNPILPTFKQKMTPKWDYLERYGTSKVLGQFFVTELAKRVSPDAVLVTTTNCGLCHGSELSREGQGHLIGYVFNVVSRLFGRSCSVGARVFVHAAANPVLGASVHGQYVEDAKLKPMSPLIYKPGDL...
Generate a protein sequence for a novel protein that integrates the following function keywords: Cytochrome P450, Cytochrome P450 superfamily, Cytochrome P450 monooxygenase, fungi, Cytochrome P450, E-class, group I. The designed protein sequence is
[ { "Beg": 31, "End": 470, "ID": "IPR001128", "Name": "Cytochrome P450", "Type": "Family" }, { "Beg": 59, "End": 78, "ID": "IPR002401", "Name": "Cytochrome P450, E-class, group I", "Type": "Family" }, { "Beg": 83, "End": 104, "ID": "IPR002401", "Name": "...
MITASSAILLVALIAALWRLSLIGQRPKDYPPGPPTLPILGNLHQIPKARRHIQFEKWARQYGPVYSLILGTKVMIVLNTEDAIRELVDKRGAIYASRPESFIAQDTISGGLRILWMHNGETWKMVRKLAHRILNITTARTYVPYQDLETKRMLVDFLEKPDSFIEHMRRFSTSLTTQMTFGFRTTTIHDPRFKESFDIFDESWELVASPVAALMDFFPFLRKIPDFLLPVKREAKKLHQREITLFRDHYFETRRKLQDGTAKPCVCVDLMKLQKEESFSDNLAAYIGGSLLQAGSETTAGVLVGFIQAITIFPSVAKIA...
Generate a protein sequence for a novel protein that integrates the following function keywords: FAD linked oxidase, N-terminal, FAD-linked Oxidoreductases in Biosynthetic Pathways, FAD-binding, type PCMH-like superfamily, Berberine/berberine-like, FAD-binding domain, PCMH-type, FAD-binding, type PCMH, subdomain 2. The...
[ { "Beg": 65, "End": 198, "ID": "IPR006094", "Name": "FAD linked oxidase, N-terminal", "Type": "Domain" }, { "Beg": 448, "End": 489, "ID": "IPR012951", "Name": "Berberine/berberine-like", "Type": "Domain" }, { "Beg": 59, "End": 229, "ID": "IPR016166", "...
MRRNILTALACSWLTAHAASVDLKSLLLESDIQWASDTVISFSDTPEFEDATVRWNSYNAPTYAGAISPADEEDVVKVVKLAKEHNVPFLATGGRHGCTDMVGLQEGLAIDLSQINSYEVDSDDATVTVGAGSTFGQFQNAIHDAGFMIQSGSVTCPGFIGITLGGGIGRYTGIFGLEIDALISARIVTADGEVLTISETENAELFWGVRGAGFNFGIVTSATYKLHKLADNNNGEILTADFIIPANKTLFYFDWLESLGETMPPNAAGVSRFQFDSIAKEGQIGANWVFIGPEDEGREFLSPILDLQPSVAMLSYVPWN...
Generate a protein sequence for a novel protein that integrates the following function keywords: Aromatic prenyltransferase, DMATS-type, Aromatic prenyltransferase DMATS-type, fungi, Aromatic prenyltransferase. The designed protein sequence is
[ { "Beg": 3, "End": 415, "ID": "IPR012148", "Name": "Aromatic prenyltransferase DMATS-type, fungi", "Type": "Family" }, { "Beg": 16, "End": 365, "ID": "IPR017795", "Name": "Aromatic prenyltransferase, DMATS-type", "Type": "Family" }, { "Beg": 4, "End": 405, ...
MPSEVLTSYYDYPTHDQEAWWRDTGPLFGRFLKGAGYDVHTQYQYLVFFIKNILPSLGPYPARWRSTITPTGLPIEYSLNFQLNSRPLLRIGFEPLSRFSGTPQDPYNKIAAADLLNQLSKLQLHEFDTQLFNHFTNEFELSKSESESLQKQGGINGKSTVRSQTAFGFDLKGGRVAVKGYAFAGLKNRATGTPVGQLISNSIRNLEPQMHCWDSFSILNSYMEESDGWNEYSFVSWDCVDIERSRLKLYGVHNAVTWDKVKEMWTLGGRIENNATIKTGLELLQHMWSLLQINEGDRDYKGGFAADNGGKTLPIIWNYE...
Generate a protein sequence for a novel protein that integrates the following function keywords: Aromatic prenyltransferase, DMATS-type, Aromatic prenyltransferase DMATS-type, fungi, Aromatic prenyltransferase. The designed protein sequence is
[ { "Beg": 1, "End": 408, "ID": "IPR012148", "Name": "Aromatic prenyltransferase DMATS-type, fungi", "Type": "Family" }, { "Beg": 18, "End": 369, "ID": "IPR017795", "Name": "Aromatic prenyltransferase, DMATS-type", "Type": "Family" }, { "Beg": 2, "End": 406, ...
MQPYHTLSRVLPFPDANQKAWWDKLGPMLLKAMQSQGYDTEAQYAQLGMVYKCVLPYLGEFPTVENDATRWKSFLCPYGIPIEPSLNISQGILRYAFEPIGPDVGTEKDPQNMNIIQDCLKGLTQHDDRIDTTLHAEFSSRLLLTEEESRQFATTGQFNFGPGQGMHGFAVDLKGSRPMFKGYFCAGIKSVVTGIPTGKLMLDAVREVDTEGRITQPLDKLEEYSANGIGKLMLCFMSVDMVNPHDARIKMYGLQQEVSREGIVDLWTLGGRVNTPTNQEGLELLLELWDLLQIPAGPRSVAISHCSVGQPPEYMLPTLV...
Generate a protein sequence for a novel protein that integrates the following function keywords: Condensation domain, Phosphopantetheine attachment site, ACP-like superfamily, AMP-binding, conserved site, AMP-binding enzyme, C-terminal domain superfamily, Phosphopantetheine binding ACP domain, ANL, N-terminal domain, A...
[ { "Beg": 14, "End": 356, "ID": "IPR000873", "Name": "AMP-dependent synthetase/ligase domain", "Type": "Domain" }, { "Beg": 1069, "End": 1394, "ID": "IPR000873", "Name": "AMP-dependent synthetase/ligase domain", "Type": "Domain" }, { "Beg": 624, "End": 1016, ...
MGSIESDSVLSFFSQRCCQNPDNTAIDDGPNGKLSYSQLDQQSSALAYCLQQNGITAGQVIPLLTTSRLEMVIAVLGILKAGGVYVPIDVDQWPADRINYVLSRTCSGLVVYTGDNIPSGVSLEEECRTVQVQIWPESALETQYEPNRRPQLMCIIFTSGTTDKPKGVMIPHSSVARFVTSPGFNYDIVPGDRLLLVLSVAFDGMGTLFNTICNGGTVILANRLNFQERSRQCTVLVVTPSILDVLSPPQSPSDYPSLERIFLGGETPSQQLLEAWSAFNDVALWIAYGPTEATCAVLSGRLQASSETGKFHPTRLGHCI...
Generate a protein sequence for a novel protein that integrates the following function keywords: Cytochrome P450 superfamily, Cytochrome P450 monooxygenase, fungi, Cytochrome P450, Cytochrome P450, E-class, group I, Cytochrome P450, conserved site. The designed protein sequence is
[ { "Beg": 50, "End": 492, "ID": "IPR001128", "Name": "Cytochrome P450", "Type": "Family" }, { "Beg": 326, "End": 339, "ID": "IPR001128", "Name": "Cytochrome P450", "Type": "Family" }, { "Beg": 361, "End": 372, "ID": "IPR001128", "Name": "Cytochrome P450...
MWDSPIIFTTMRELVQSVSPAALSWAVVAIYLGTFFWLRSRSSKQRLPLPPGPRGLPLIGNSLQTPAVNPWEKYKEWSDEYGPVMTLSLGLTTTIILSSHQVANDLMEKKSTIYSSRPQLVMFNRLSGGMNSSGMEYGKRWRDHRSLQASVLRPWMTQRYTALRDVETKQLLAELLNTDDFSSCFKRMVASLFMTLAYGKRVQYPDDPEIRGMEELVRVKSEAGEASFRATGQLVEYIPLLQYLPSFLTPWKEMCDRICEQFNKTFVDRLRDGINAPAWTWAKEVSKHKVARPMSELEISYTLGTLYEASLTSQQILRII...
Generate a protein sequence for a novel protein that integrates the following function keywords: Evasins Class A. The designed protein sequence is
[ { "Beg": 38, "End": 110, "ID": "IPR045797", "Name": "Evasins Class A", "Type": "Family" } ]
MKVLLYIAASCLMLLALNVSAENTQQEEEDYDYGTDTCPFPVLANKTNKAKFVGCHQKCNGGDQKLTDGTACYVVERKVWDRMTPMLWYSCPLGECKNGVCEDLRKKEECRKGNGEEK
Generate a protein sequence for a novel protein that integrates the following function keywords: Evasins Class A. The designed protein sequence is
[ { "Beg": 38, "End": 110, "ID": "IPR045797", "Name": "Evasins Class A", "Type": "Family" } ]
MKVLLCIAASCLMLLALNVSAENTQQEEQDYDYGTDTCPFPVLANKTNKAKFVGCHQKCNGGDQKLTDGTACYVVERKVWDRMTPMLWYECPLGECKNGVCEDLRKKEDCRKGNGEEK
Generate a protein sequence for a novel protein that integrates the following function keywords: Evasins Class A. The designed protein sequence is
[ { "Beg": 37, "End": 111, "ID": "IPR045797", "Name": "Evasins Class A", "Type": "Family" } ]
MKASFCVIASCLVVFALKGTAEDTGTEDDFDYGNTGCPFPVLGNYKSNMTKPVGCKNKCGSGYEVLNDTTPCYVIDQKVFNNMVPLRQYSKCPLGFCENGECKPNDQAEDCYKGREEQK
Generate a protein sequence for a novel protein that integrates the following function keywords: Evasins Class A. The designed protein sequence is
[ { "Beg": 55, "End": 128, "ID": "IPR045797", "Name": "Evasins Class A", "Type": "Family" } ]
MHSTIVYACLLALAVFVALHGTPLAALAENGEGTTQPDYDNSTDYYNYEDFKCTCPAPHLNNTNGTVMKPIGCYYTCNVTRCTAPDTYPCYNLTEHQAKNLTTSPTTLCAVGNCDHGICVPNGTKELCFKAPNLEE
Generate a protein sequence for a novel protein that integrates the following function keywords: Evasins Class A. The designed protein sequence is
[ { "Beg": 48, "End": 123, "ID": "IPR045797", "Name": "Evasins Class A", "Type": "Family" } ]
MHSTIAYVSLLPLALFVAMHGASTDEESEELGASTDVDYEELDANCTCPAPALTSTRNNKHYPLGCIYNCSSYNCTIPDGTPCYVLTLGEVKEHLQIGSTVPNCTCGLCRNGTCVSNGTVEECFAVEEIEET
Generate a protein sequence for a novel protein that integrates the following function keywords: Evasins Class A. The designed protein sequence is
[ { "Beg": 38, "End": 109, "ID": "IPR045797", "Name": "Evasins Class A", "Type": "Family" } ]
MARNWSFRVIFVSAMWCALLKFATLEEPKDGYDYTEGCPFVVLGNGTHAKPAGCSHLCNGAPETLDDNMECYNVTEEVAKRMTPDIPYTCWLGWCSKGECKRDNRTEVCYRGSERE
Generate a protein sequence for a novel protein that integrates the following function keywords: Evasins Class A. The designed protein sequence is
[ { "Beg": 38, "End": 108, "ID": "IPR045797", "Name": "Evasins Class A", "Type": "Family" } ]
MTRNWSFRVIFVSAMWCALLKFATLEAPKDDFEYDGGCPFVVLDNGTHVKPAGCSHLCNGAPETLDNIECYNVTEEVAKRMTPGIPYACWLGWCSKGECKRDNRTEVCYRGSEEE
Generate a protein sequence for a novel protein that integrates the following function keywords: Leguminous Lectin, Legume lectin, beta chain, Mn/Ca-binding site, Legume lectin domain, Legume lectin, alpha chain, conserved site, Concanavalin A-like lectin/glucanase domain superfamily. The designed protein sequence is
[ { "Beg": 85, "End": 94, "ID": "IPR000985", "Name": "Legume lectin, alpha chain, conserved site", "Type": "Conserved_site" }, { "Beg": 3, "End": 123, "ID": "IPR001220", "Name": "Legume lectin domain", "Type": "Domain" }, { "Beg": 126, "End": 235, "ID": "IPR...
ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQNGKVGTAHIIYNSVGKRLSAVVSYPNGDSATVSYDVDLDNVLPEWVRVGLSATTGLYKETNTILSWSFTSKLKSNSTHETNALHFMFNQFSKDQKDLILQGDATTGRDGNLELTRVSSNGSPQGSSVGRALFYAPVHIWESSAVVASFDATFTFLIKSSDSHPADGIAFFISNIDSSIPSGSTGRLLGLFPDAN
Generate a protein sequence for a novel protein that integrates the following function keywords: CdiI, C-terminal, Contact-dependent growth inhibition immunity. The designed protein sequence is
[ { "Beg": 35, "End": 139, "ID": "IPR040509", "Name": "CdiI, C-terminal", "Type": "Domain" }, { "Beg": 1, "End": 145, "ID": "IPR053755", "Name": "Contact-dependent growth inhibition immunity", "Type": "Homologous_superfamily" } ]
MFGIFSKGEPVSMEGELVQPSSIVINDYEEELHLPLSYWDIKDYKNSWLKSLGEGLSNKTHSALAVSMYEPEKTNFIFTWVLYFEDEKVYVQNNVIFLEECHGFSPENINKFIESRTTHDGDGMKISEWHTDLNSVLDFYHSLNN
Generate a protein sequence for a novel protein that integrates the following function keywords: Isopenicillin N synthase-like, Fe(2+) 2OG dioxygenase domain, Oxoglutarate/iron-dependent dioxygenase domain, Non-haem dioxygenase N-terminal domain, Isopenicillin N synthase-like superfamily. The designed protein sequence ...
[ { "Beg": 209, "End": 319, "ID": "IPR005123", "Name": "Oxoglutarate/iron-dependent dioxygenase domain", "Type": "Domain" }, { "Beg": 66, "End": 166, "ID": "IPR026992", "Name": "Non-haem dioxygenase N-terminal domain", "Type": "Domain" }, { "Beg": 20, "End": 350...
MAPTKDFSTTTTNGAESWDDVADFVTKKGHGVKGLSERGIKTLPKPFHQPLEERFSEKKILERASIPLIDMSQWDSPEVVKSICDAAENWGFFQIVNHGVPLETLERVKEATHRFFGLPAEEKNNYSKENSPINNVRFGSSFVPHVEKALEWKDFLSMFYVSEEETNTYWPPICRDEMLEYMRSSEVLIQRLMEVLVVKGLKVKQIDEIREPMLVGSRRINLNYYPKCPNPELTLGVGRHSDISTFTILLQDQIGGLHVRKLDDTGNTWVHVTPIAGSLIINIGDALQIMSNGRYKSIEHMVVANGTQDRISVPLFVNPK...
Generate a protein sequence for a novel protein that integrates the following function keywords: Isopenicillin N synthase-like, Fe(2+) 2OG dioxygenase domain, Oxoglutarate/iron-dependent dioxygenase domain, Non-haem dioxygenase N-terminal domain, Isopenicillin N synthase-like superfamily. The designed protein sequence ...
[ { "Beg": 215, "End": 318, "ID": "IPR005123", "Name": "Oxoglutarate/iron-dependent dioxygenase domain", "Type": "Domain" }, { "Beg": 65, "End": 165, "ID": "IPR026992", "Name": "Non-haem dioxygenase N-terminal domain", "Type": "Domain" }, { "Beg": 19, "End": 349...
MAPTKDFSTATNGADSWDDVADFVTKKGHGVKGLSERGIKTLPKPFHQPLEERFSEKKILERASIPLIDMSEWDSPEVVKSICDAAENWGFFQIVNHGVPLETLERVKEATHRFFGLPAEEKNKYSKENSPINNVRFGSSFVPHVEKALEWKDFLSMFYVSXEETNTYWPPICXDQMLEYMRSSEVLIKRLMEVLVVKGLKVKQIDEIREPMLVGSRRVNLNYYPKCPNRELTLGVGRHSDISTFTILLQDQIEVLHVRKLDDTGNTWVHVTPIAGSLIINIGDALQIMSNGRYKSIEHMVVANGTQDRISVPLFVNPKP...
Generate a protein sequence for a novel protein that integrates the following function keywords: Short-chain dehydrogenase/reductase SDR, NAD(P)-binding domain superfamily. The designed protein sequence is
[ { "Beg": 49, "End": 231, "ID": "IPR002347", "Name": "Short-chain dehydrogenase/reductase SDR", "Type": "Family" }, { "Beg": 113, "End": 124, "ID": "IPR002347", "Name": "Short-chain dehydrogenase/reductase SDR", "Type": "Family" }, { "Beg": 174, "End": 182, ...
MIPRWQPASIPLLLHLDTLRCHHVSVQPPRATMTSLNIKEEDIPRLDGKVVVISGGASGIGLAAANIFARAGAKIFLFDCNPPDSGEAPENSTFIKADITSWAELKAAFAQAGHVDIAVANAGVSEEQPYFEDTFDEQGELKEPGFAVVDVNFKGTVMFTKLAVSYMRKQGKGGSVVITASATGYAPEQNLPVYSAIKSGLVGLVRSLRSTLPRFDISINAVAPAATITKLLPMDIAGPLMAAGLPVSSAHMVGLAVVYSAVARQPRMVETYGKENVLDLESKWNGRTILTLGEHYTELEEKLADLRPVWFGWRNTDLTK...
Generate a protein sequence for a novel protein that integrates the following function keywords: FAD linked oxidase, N-terminal, FAD-linked Oxidoreductases in Biosynthetic Pathways, FAD-binding, type PCMH-like superfamily, FAD-binding domain, PCMH-type, FAD-binding, type PCMH, subdomain 2. The designed protein sequence...
[ { "Beg": 67, "End": 201, "ID": "IPR006094", "Name": "FAD linked oxidase, N-terminal", "Type": "Domain" }, { "Beg": 63, "End": 235, "ID": "IPR016166", "Name": "FAD-binding domain, PCMH-type", "Type": "Domain" }, { "Beg": 34, "End": 265, "ID": "IPR016169", ...
MLSLKAFLALSLSIHLSQGLVASVSHRRANACTELSRSYPDSTIHPGSSVFAEDVIEPWSQTCQTTPTCVFAPASAEEVAGGLAILRKADQTFAVRTQGHMPIPGAADISNGVLMVTTSLNSVQYADDSKSVVQIGAGNRWLDVYKVLAKDNLAVVGGRFGQVGVSGLLLGGGISYFNSDHGWGANSVVNYEVVLANGTVCAANAQQNSDLYWALKGGSFNFGIVTRFDLATFSVPYMWGGSAFYDASALDPLVNAYASYAVASGGSSDPAAHSDPSILYNVTTGEVSGYGIYMHRGDDPAPAALKNFTDIPSTFQDFRV...
Generate a protein sequence for a novel protein that integrates the following function keywords: Short-chain dehydrogenase/reductase SDR, NAD(P)-binding domain superfamily. The designed protein sequence is
[ { "Beg": 49, "End": 252, "ID": "IPR002347", "Name": "Short-chain dehydrogenase/reductase SDR", "Type": "Family" }, { "Beg": 50, "End": 67, "ID": "IPR002347", "Name": "Short-chain dehydrogenase/reductase SDR", "Type": "Family" }, { "Beg": 123, "End": 134, "...
MANPLISNHIGKHGKYTQAFLEQNGPGDARPTALDILKDNDRIDNMKDKVFLLTGSSGGIGIETGRALAATGGKVYLGVRDLEKGKQALAEILEPGRVELLELDVGSMESVRTAAKTFLSKSTQLNVLVNNAGIMACPEAKTVDGFESQLAINYLGHFLLYKLLEQTLLSSSTPEFQSRVVNVSSAGHHMSSVVLDNINLEGEYEPWKAYGNAKTACIWMTNEIEHRYGSKGLHGLSLMPGGIATSLQRHVDPETLKEWGSSEFAQKYAKSSAQGAATTITAALGKEWEGKGGVYLEDCQEAGPVPEGGTLAVGVAPHAF...
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycosyl hydrolase family 81, N-terminal, Glycosyl hydrolase family 81, C-terminal domain, Endo-1,3(4)-beta-glucanase. The designed protein sequence is
[ { "Beg": 31, "End": 759, "ID": "IPR005200", "Name": "Endo-1,3(4)-beta-glucanase", "Type": "Family" }, { "Beg": 26, "End": 744, "ID": "IPR005200", "Name": "Endo-1,3(4)-beta-glucanase", "Type": "Family" }, { "Beg": 51, "End": 377, "ID": "IPR040451", "Nam...
MRFQVIVAAATITMITSYIPGVASQSTSDGDDLFVPVSNFDPKSIFPEIKHPFEPMYANTENGKIVPTNSWISNLFYPSADNLAPTTPDPYTLRLLDGYGGNPGLTIRQPSAKVLGSYPPTNDVPYTDAGYMINSVVVDLRLTSSEWSDVVPDRQVTDWDHLSANLRLSTPQDSNSYIDFPIVRGMAYITANYNNLTPQFLSQHAIISVEADEKKSDDNTSTFSGRKFKITMNDDPTSTFIIYSLGDKPLELRKQDNSNLVASKPYTGVIRVAKLPAPEFETLLDASRAVWPTGGDISARSDDNNGASYTIKWKTNSNEA...
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 31, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPVWIGYSPCVGDDCIALLTRGEGLC
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 30, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATCLPAWLALCPCVGDDVNPTLTRGGT
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 30, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINGTRLPWLATCPCVGEDVNPTLSRGER
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 32, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPIWGIGCDPCVGDDVTAVLTRGEA
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 32, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPIWGIGCNPCVGDEVTALLTRGEA
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 31, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPVWIGYSPCVGDDAVALLNRGEG
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 32, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPLILLAALGIPSDDADSTLTRGER
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 32, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPIWGIGCDPCVGDEVTALLTRGEA
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 32, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPIWGIGCNPSVGDEVTALLTSGEA
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 31, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPHLVRYPPYVGDGTDLTLNRGEK
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 32, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPIFWFIYFPCVGDNVDNTLTRGER
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 32, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPIWGIGCDPCVGDEVTALLTRGEA
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 31, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPAWLVDCPCVGDDINRLLTRGEK
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 31, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPVWIGCSPCVGDDCIALLTRGEG
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 31, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPSFFFPIPCISDDIEMVLTRGER
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 31, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRVPAWLAECPCVGDDISHLLTRGEK
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 32, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPIWGIGCDPCVGDEVTALLTRGEA
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 32, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPIWGIGCNPCVGDEVTALITRGEA
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 31, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPIIWAPVVPCISDDNDSTLTRGQR
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 32, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPIILAPIIPCINDDVNSTLTSGER
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 34, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPIIIVLGLIIPLCVSDIEMILTRGER
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 32, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPIWGIGCDPCVGDDVAALTTRGEA
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 32, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
MSDINATRLPIWGIGCNPSVGDEVTALLASGEA
Generate a protein sequence for a novel protein that integrates the following function keywords: P-loop containing nucleoside triphosphate hydrolase, Helicase, C-terminal domain-like. The designed protein sequence is
[ { "Beg": 2, "End": 41, "ID": "IPR001650", "Name": "Helicase, C-terminal domain-like", "Type": "Domain" }, { "Beg": 1, "End": 64, "ID": "IPR027417", "Name": "P-loop containing nucleoside triphosphate hydrolase", "Type": "Homologous_superfamily" }, { "Beg": 2, "...
MQVLIGTKLVTEGIDIKQLMMVIMLDNRLNIIELIQGVGRLRDGGLCYLLSRKNSWAARNRKGELPPIKEGCITEQVREFYGLESKKGKKGPACWMLWLQDRPVC
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 22, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
PAWLVDCPCVGDDVNRLLARGEK
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 22, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
PAWLVDCPCVGDDISRLLTRGEK
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 22, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
PAWLVDCPCVGDDVNRLLTRGER
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 22, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
PAWLVDCPCVGDDINRLLTRGEK
Generate a protein sequence for a novel protein that integrates the following function keywords: Amanitin/phalloidin toxin. The designed protein sequence is
[ { "Beg": 1, "End": 21, "ID": "IPR027582", "Name": "Amanitin/phalloidin toxin", "Type": "Family" } ]
PAWLVDCPCVGDDVNFILTRGQK
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycoside hydrolase superfamily, Glycoside hydrolase, family 5, conserved site, Glycoside hydrolase, family 5. The designed protein sequence is
[ { "Beg": 23, "End": 304, "ID": "IPR001547", "Name": "Glycoside hydrolase, family 5", "Type": "Domain" }, { "Beg": 25, "End": 317, "ID": "IPR017853", "Name": "Glycoside hydrolase superfamily", "Type": "Homologous_superfamily" }, { "Beg": 151, "End": 160, "I...
MPRMLAASAAIIATTLAPLSAQAAGCEMTLHGINLSGAEFGQPGDPYGQGYIYPSESTIKAFADDGFNAVRLPFLWERLQPTLNGTLDATELSRIKDTVETLRDNGMVVILDVHNYARYHGEMIGTPNVPVAAFADFWKRLSAVFANDDDVIFGLMNEPHDISAPAWLAAANAAIDAIRTIGAGNLVLVPGTAWTGAHSWSQTFYGPSNASVMAQVVDSSNNFAYEVHQYTDDDFSGKNADCSKIDDAVSALNDFTSWLNANDVQGFLGEFGTTEQIQCLRGLKQMVDVVQQNPRAWLGWAYWAGGDWWPKDSPMIIHSN...
Generate a protein sequence for a novel protein that integrates the following function keywords: D-aminoacyl-tRNA deacylase-like superfamily, D-aminoacyl-tRNA deacylase DTD. The designed protein sequence is
[ { "Beg": 1, "End": 145, "ID": "IPR003732", "Name": "D-aminoacyl-tRNA deacylase DTD", "Type": "Family" }, { "Beg": 2, "End": 144, "ID": "IPR003732", "Name": "D-aminoacyl-tRNA deacylase DTD", "Type": "Family" }, { "Beg": 1, "End": 147, "ID": "IPR003732", ...
MKLVVQRVTDASVTVDGAVAGRIGPGIMALVGVTHEDTEEDAAYLADKIVNLRIFDDESGKMNLSLLDTGGEILSVSQFTLYGETKKGRRPNFMNAAKPDQALLLYEKWNELLREKGVKVETGIFGAMMDVQLTNSGPVTLIMDSKQ
Generate a protein sequence for a novel protein that integrates the following function keywords: Plant defense and hormone signaling protein, START-like domain superfamily, Bet v I/Major latex protein, Bet v I type allergen. The designed protein sequence is
[ { "Beg": 1, "End": 155, "ID": "IPR000916", "Name": "Bet v I/Major latex protein", "Type": "Domain" }, { "Beg": 2, "End": 159, "ID": "IPR023393", "Name": "START-like domain superfamily", "Type": "Homologous_superfamily" }, { "Beg": 3, "End": 23, "ID": "IPR0...
MGVFTYETEFTSVIPPPRLYKAFVLDADNLIPKIAPQAVKSAEIVQGDGGVGTIKKIHLGEGSEYSYVKHQIDGLDKDNFVYNYSIIEGDAIGDKVEKISYEIKLVASPSGGSIIKSTSHYHCKGEVEIKEEHVKAGKEKAAGLFKIIENHLLANPEAYN
Generate a protein sequence for a novel protein that integrates the following function keywords: Plant defense and hormone signaling protein, START-like domain superfamily, Bet v I/Major latex protein, Bet v I type allergen. The designed protein sequence is
[ { "Beg": 1, "End": 155, "ID": "IPR000916", "Name": "Bet v I/Major latex protein", "Type": "Domain" }, { "Beg": 2, "End": 158, "ID": "IPR023393", "Name": "START-like domain superfamily", "Type": "Homologous_superfamily" }, { "Beg": 3, "End": 23, "ID": "IPR0...
MGVFTYETEFTSVIPPPRLFKAFILDADNLIPKIAPQAVKCAEIIEGDGGVGTIKKITFGEGSQFGSVTHKIDGIDKDNFAYSYSLVEGDALSDKIEKISYETKLVASSDGGSVIKSTSNYHTKGDVEIKEEHVKAGKEKASHLFKLVEDYLLANPNEYC
Generate a protein sequence for a novel protein that integrates the following function keywords: Plant defense and hormone signaling protein, START-like domain superfamily, Bet v I/Major latex protein, Bet v I type allergen. The designed protein sequence is
[ { "Beg": 1, "End": 155, "ID": "IPR000916", "Name": "Bet v I/Major latex protein", "Type": "Domain" }, { "Beg": 2, "End": 158, "ID": "IPR023393", "Name": "START-like domain superfamily", "Type": "Homologous_superfamily" }, { "Beg": 3, "End": 23, "ID": "IPR0...
MGVFTYETEFTSVIPPPRLFKAFILDADNLIPKIAPQAVKCAEIVEGDGGVGTIKKITFGEGSQFGSVTHKIDGIDKENFVYSYSLVEGDALSDKIEKISYETKLVASSDGGSVIKSTSNYHTKGDVEIKEEHVKAGKEKASHLFKLVEDYLLANPNEYC
Generate a protein sequence for a novel protein that integrates the following function keywords: Plant defense and hormone signaling protein, START-like domain superfamily, Bet v I/Major latex protein, Bet v I type allergen. The designed protein sequence is
[ { "Beg": 1, "End": 155, "ID": "IPR000916", "Name": "Bet v I/Major latex protein", "Type": "Domain" }, { "Beg": 2, "End": 158, "ID": "IPR023393", "Name": "START-like domain superfamily", "Type": "Homologous_superfamily" }, { "Beg": 3, "End": 23, "ID": "IPR0...
MGVFTYETEFTSVIPPPRLFKAFILDADNLIPKIAPQAVKCAEIIEGDGGVGTIKKITFGEGSQFGSVTHKIDGIDKDNFVYSYSLVEGDALSDKIEKISYETKLVASSDGGSIIKSTSNYHTKGDVEIKEEHVKAGKEKASHLFKLVEGYLLANPNEYC
Generate a protein sequence for a novel protein that integrates the following function keywords: Plant defense and hormone signaling protein, START-like domain superfamily, Bet v I/Major latex protein, Bet v I type allergen. The designed protein sequence is
[ { "Beg": 1, "End": 154, "ID": "IPR000916", "Name": "Bet v I/Major latex protein", "Type": "Domain" }, { "Beg": 2, "End": 159, "ID": "IPR023393", "Name": "START-like domain superfamily", "Type": "Homologous_superfamily" }, { "Beg": 3, "End": 23, "ID": "IPR0...
MGVFTYETEFTSVIPPPRLYKAFVLDTDNLIPKIAPQAVKSTELVQGDGGVGTIKKIHLGEGSEYSYVKHQIDGLDKDNFVYNYSIIEGDAIGDKVEKISYEIKLVASPSGGSIIKSTSHYHCKGEVEIKEEHVKAGKERAAGLFKIIENYLLGNPDAYN
Generate a protein sequence for a novel protein that integrates the following function keywords: Transcription factor GRAS. The designed protein sequence is
[ { "Beg": 223, "End": 588, "ID": "IPR005202", "Name": "Transcription factor GRAS", "Type": "Family" }, { "Beg": 212, "End": 588, "ID": "IPR005202", "Name": "Transcription factor GRAS", "Type": "Family" }, { "Beg": 198, "End": 582, "ID": "IPR005202", "Na...
MAYMCADSGNLMAIAQQVIKQKQQQEQQQQQSHHPQQQFLGLNPFSLNPWPSTTMSANPNLGYGLSGPAAFSDPFQSGPDTGDPPGFSFSNMEHQHSGGFRFPDFTGAGGEFDSDEWMDSLMNGGDSTDSSNLPSGCDAWQNNADFGIYPSDPFNTSPSRLTVGCSPPSDLNRVISDSLWADPSPQEIKPKTSPPQQPPPTAKNEVVVGSKEVVELSSSPVLKAFVECAQLVESKVDQAVKSLIKLKESVSENGDPGERVGFYFVQGLCRRVAVGELDDLKNFHQTTSEEFTLSYKALNDACPYSKFAHLTANQAILEAT...
Generate a protein sequence for a novel protein that integrates the following function keywords: Flavivridae NS3 helicase, C-terminal helical domain, Flaviviral glycoprotein E, central domain, subdomain 1, Flavivirus/Alphavirus glycoprotein, immunoglobulin-like domain superfamily, Flavivirus non-structural protein NS2A...
[ { "Beg": 217, "End": 290, "ID": "IPR000069", "Name": "Envelope glycoprotein M, flavivirus", "Type": "Domain" }, { "Beg": 2772, "End": 3222, "ID": "IPR000208", "Name": "RNA-directed RNA polymerase, fingers/palm subdomains, flavivirus", "Type": "Domain" }, { "Beg": ...
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKKRRGADTSVGIVGLLLTTAMAAEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKVIYLVMILLIAPAYSIRCIGVSNRDFVEGMSGGTWVDVVLEHGGC...
Generate a protein sequence for a novel protein that integrates the following function keywords: Flavin monoamine oxidase and related enzymes, Amine oxidase, FAD/NAD(P)-binding domain superfamily. The designed protein sequence is
[ { "Beg": 45, "End": 482, "ID": "IPR002937", "Name": "Amine oxidase", "Type": "Domain" }, { "Beg": 37, "End": 483, "ID": "IPR036188", "Name": "FAD/NAD(P)-binding domain superfamily", "Type": "Homologous_superfamily" }, { "Beg": 34, "End": 484, "ID": "IPR036...
SCADDRNPLEECFQETDYEEFLEIARNGLKATSNPKHVVIVGAGMSGLSAAYVLAGAGHQVTVLEASERAGGRVRTYRNDKEGWYANLGPMRLPEKHRIVREYITKFGLQLNEFSQENENAWYFIKNIRKRVGEVKKDPGLLQYPVKPSEEGKSAGQLYEESLGKVVEELKRTNCSYILDKYDTYSTKEYLIKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDNIFGYEKRFNEIVDGMDKLPTSMYQAIEEKVRFNARVIKIQQNDNEVTVTYQTSENEMSPVTADYVIVCTTSRAARRITFEPPLPPKKAHALRS...
Generate a protein sequence for a novel protein that integrates the following function keywords: HotDog domain superfamily, Post-transcriptional expression and antimicrobial biosynthesis protein. The designed protein sequence is
[ { "Beg": 94, "End": 221, "ID": "IPR029069", "Name": "HotDog domain superfamily", "Type": "Homologous_superfamily" }, { "Beg": 26, "End": 223, "ID": "IPR052061", "Name": "Post-transcriptional expression and antimicrobial biosynthesis protein", "Type": "Family" } ]
MEVKKLEFIGPRVMPGGQKEMDYFCQVPEFQQRCQSGNAVVIPRRDQVADGRGSTGKLFSQTLNTADTIPHCIVMFEDTYTAQSSTQPWLPISTCSVFYQLGEGVCGFGNICHGGIQTTLLDDVMGVLGVLNARLQDGIIPSKVPGAYWPRNNPGMVDLTKSLFATQGIEVKFLRPLRTPQVIEVSAQLVDMDVSGGSFTVQCVIRDMKGKQYAVANANWVIHTPRPRSRL
Generate a protein sequence for a novel protein that integrates the following function keywords: Condensation domain, Phosphopantetheine attachment site, ACP-like superfamily, AMP-binding, conserved site, AMP-binding enzyme, C-terminal domain superfamily, Phosphopantetheine binding ACP domain, Polyketide synthase-like,...
[ { "Beg": 989, "End": 1330, "ID": "IPR000873", "Name": "AMP-dependent synthetase/ligase domain", "Type": "Domain" }, { "Beg": 2547, "End": 2887, "ID": "IPR000873", "Name": "AMP-dependent synthetase/ligase domain", "Type": "Domain" }, { "Beg": 4114, "End": 4457,...
MDAPDIQAPSGSCRTTLGKVAADIFEMNVETLDWDMSFIQMGGDSILAIDFIVRCRDEGIWVDMMDLLTVDTLAELADSIDEQNGVTADVANSSDLNEHETHQENGENINATLPVADRPLRFASMEIAHVKDASLVSSALESLITRHSALRSVWSVSSTGEYTLTTKPTAMAYESQPFFLAEASEPTKMNDAFELLKNALRSDGAPPLGCLFISNNATTASSIIVLAADANLVDSLSMRILRTEFREFILGHALDAPPGFQFSNWVAAKCQSTTARPRTLQQPQRAMERAIATKLSSSTSSADSSSNEATITTFQITHST...
Generate a protein sequence for a novel protein that integrates the following function keywords: AMP-dependent synthetase/ligase domain, AMP-binding enzyme, C-terminal domain superfamily, AMP-binding enzyme, C-terminal domain, ANL, N-terminal domain. The designed protein sequence is
[ { "Beg": 51, "End": 423, "ID": "IPR000873", "Name": "AMP-dependent synthetase/ligase domain", "Type": "Domain" }, { "Beg": 480, "End": 562, "ID": "IPR025110", "Name": "AMP-binding enzyme, C-terminal domain", "Type": "Domain" }, { "Beg": 27, "End": 466, "ID...
MIFTQPSFVPALPSPLPLGETIGDFCMSERLAKVGNDAVEEQPIPFIDAAIDKSWTTDEINTRVAQLTRALATEWNIAPGEKWHKQVAVLASNCVSIFMDTLILTWAIHRLGGGCLMLQPTSSVEEMAAHIDHVPPFAMFVTLDLVTLGQETIQKSSQSADLPFYKFSKVYGPPAKNAPDTSNVKSLDALLEKSKDQAPIEKLLLAEGEGSKRVAYYCTTSGTGGFQRIVAITHENIIASILQAGLFTGITKEKSEIALVFTPFNHIYGLLTAHTLMWLGHSTVIHRGFNMLEVLMSIPKRRITTLYLVPPIINAMSRNA...
Generate a protein sequence for a novel protein that integrates the following function keywords: Sterol Desaturase and Related Enzymes, Fatty acid hydroxylase. The designed protein sequence is
[ { "Beg": 189, "End": 335, "ID": "IPR006694", "Name": "Fatty acid hydroxylase", "Type": "Domain" }, { "Beg": 158, "End": 338, "ID": "IPR050307", "Name": "Sterol Desaturase and Related Enzymes", "Type": "Family" } ]
MPSTTQTTVQSIDSIDSIPTTIKRRQNDKTKTPKTKPVSKIPICPKNSSIPRLDQPSQHKFILLQSLLPITVHQLTTLVLSISRYDDYVHPFLLRLCVIIGYGYAFRFLLRREGLAIRTLGKKLGYLDGDHHPRDKVPRDSTRLNWSLPLTVGSRTVMCVLVAYDPSQQPINYLASLKWWAWLAVYLSLYPIILDFYYYCVHRAWHEVPCLWRFHRRHHTIKRPSILFTAYADSEQELFDIVGTPLLTFFTLKALHLPMDFYTWWICIQYIAYTEVMGHSGLRIYTTPPISCSWLLQRFGVELVIEDHDLHHRQGYRQAR...
Generate a protein sequence for a novel protein that integrates the following function keywords: Gamma-carboxyglutamic acid-rich (GLA) domain superfamily, Osteocalcin, Gamma-carboxyglutamic acid-rich (GLA) domain. The designed protein sequence is
[ { "Beg": 131, "End": 163, "ID": "IPR000294", "Name": "Gamma-carboxyglutamic acid-rich (GLA) domain", "Type": "Domain" }, { "Beg": 131, "End": 164, "ID": "IPR035972", "Name": "Gamma-carboxyglutamic acid-rich (GLA) domain superfamily", "Type": "Homologous_superfamily" }, ...
MKSLTLLTICAVLSVSLSMNDLALDVVLDPAPDPATEPAPAADSSASSSASSSSSSASDSSASASDSSDSDSSSASSSSSSSESASAEVTTEDPAAATEPEVVIMKRDLASVLLRRKRAAGQAAAAFTLTQVESLSEVCELNLACEHMAETAGIVAAYTAYYGPPPF
Generate a protein sequence for a novel protein that integrates the following function keywords: Translation machinery associated TMA7. The designed protein sequence is
[ { "Beg": 3, "End": 64, "ID": "IPR015157", "Name": "Translation machinery associated TMA7", "Type": "Family" }, { "Beg": 1, "End": 64, "ID": "IPR015157", "Name": "Translation machinery associated TMA7", "Type": "Family" } ]
MSSHEGGKKKALKQPKKQAKEMDEEEKAFKQKQKEEQKKLEVLKAKVVGKGPLATGGIKKSGKK
Generate a protein sequence for a novel protein that integrates the following function keywords: NUDIX hydrolase-like domain superfamily, NUDIX hydrolase domain, NUDIX hydrolase, conserved site, Diphosphoinositol polyphosphate phosphohydrolase-like, NUDIX domain. The designed protein sequence is
[ { "Beg": 20, "End": 143, "ID": "IPR000086", "Name": "NUDIX hydrolase domain", "Type": "Domain" }, { "Beg": 18, "End": 145, "ID": "IPR000086", "Name": "NUDIX hydrolase domain", "Type": "Domain" }, { "Beg": 11, "End": 147, "ID": "IPR015797", "Name": "NUD...
MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycoside hydrolase, family 7, Cellulose-binding domain superfamily, Glycoside hydrolase family 7, catalytic domain superfamily, Cellulose-binding domain, fungal, Concanavalin A-like lectin/glucanase domain superfamily. The...
[ { "Beg": 482, "End": 510, "ID": "IPR000254", "Name": "Cellulose-binding domain, fungal", "Type": "Domain" }, { "Beg": 486, "End": 513, "ID": "IPR000254", "Name": "Cellulose-binding domain, fungal", "Type": "Domain" }, { "Beg": 478, "End": 514, "ID": "IPR00...
MYRKLAVISAFLATARAQSACTLQSETHPPLTWQKCSSGGTCTQQTGSVVIDANWRWTHATNSSTNCYDGNTWSSTLCPDNETCAKNCCLDGAAYASTYGVTTSGNSLSIGFVTQSAQKNVGARLYLMASDTTYQEFTLLGNEFSFDVDVSQLPCGLNGALYFVSMDADGGVSKYPTNTAGAKYGTGYCDSQCPRDLKFINGQANVEGWEPSSNNANTGIGGHGSCCSEMDIWEANSISEALTPHPCTTVGQEICEGDGCGGTYSDNRYGGTCDPDGCDWNPYRLGNTSFYGPGSSFTLDTTKKLTVVTQFETSGAINRY...
Generate a protein sequence for a novel protein that integrates the following function keywords: Alpha/Beta hydrolase fold, Cutinase, serine active site, Cutinase, monofunctional, Cutinase/acetylxylan esterase, Cutinase, aspartate and histidine active sites. The designed protein sequence is
[ { "Beg": 78, "End": 244, "ID": "IPR000675", "Name": "Cutinase/acetylxylan esterase", "Type": "Family" }, { "Beg": 77, "End": 247, "ID": "IPR000675", "Name": "Cutinase/acetylxylan esterase", "Type": "Family" }, { "Beg": 99, "End": 109, "ID": "IPR011150", ...
MRSLAILTTLLAGHAFAYPKPAPQSVNRRDWPSINEFLSELAKVMPIGDTITAACDLISDGEDAAASLFGISETENDPCGDVTVLFARGTCDPGNVGVLVGPWFFDSLQTALGSRTLGVKGVPYPASVQDFLSGSVQNGINMANQIKSVLQSCPNTKLVLGGYSQGSMVVHNAASNLDAATMSKISAVVLFGDPYYGKPVANFDAAKTLVVCHDGDNICQGGDIILLPHLTYAEDADTAAAFVVPLVS
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycoside hydrolase, family 5, conserved site, Glycoside hydrolase, family 5, Glycoside hydrolase superfamily, Cellulose-binding domain superfamily, Cellulose-binding domain, fungal. The designed protein sequence is
[ { "Beg": 26, "End": 53, "ID": "IPR000254", "Name": "Cellulose-binding domain, fungal", "Type": "Domain" }, { "Beg": 29, "End": 56, "ID": "IPR000254", "Name": "Cellulose-binding domain, fungal", "Type": "Domain" }, { "Beg": 21, "End": 57, "ID": "IPR000254",...
MNKSVAPLLLAASILYGGAAAQQTVWGQCGGIGWSGPTNCAPGSACSTLNPYYAQCIPGATTITTSTRPPSGPTTTTRATSTSSSTPPTSSGVRFAGVNIAGFDFGCTTDGTCVTSKVYPPLKNFTGSNNYPDGIGQMQHFVNDDGMTIFRLPVGWQYLVNNNLGGNLDSTSISKYDQLVQGCLSLGAYCIVDIHNYARWNGGIIGQGGPTNAQFTSLWSQLASKYASQSRVWFGIMNEPHDVNINTWAATVQEVVTAIRNAGATSQFISLPGNDWQSAGAFISDGSAAALSQVTNPDGSTTNLIFDVHKYLDSDNSGTH...
Generate a protein sequence for a novel protein that integrates the following function keywords: Cellulose-binding domain superfamily, 1, 4-beta cellobiohydrolase superfamily, 1, 4-beta cellobiohydrolase, Cellulose-binding domain, fungal, Glycoside hydrolase, family 6, conserved site. The designed protein sequence is
[ { "Beg": 31, "End": 58, "ID": "IPR000254", "Name": "Cellulose-binding domain, fungal", "Type": "Domain" }, { "Beg": 34, "End": 61, "ID": "IPR000254", "Name": "Cellulose-binding domain, fungal", "Type": "Domain" }, { "Beg": 26, "End": 62, "ID": "IPR000254",...
MIVGILTTLATLATLAASVPLEERQACSSVWGQCGGQNWSGPTCCASGSTCVYSNDYYSQCLPGAASSSSSTRAASTTSRVSPTTSRSSSATPPPGSTTTRVPPVGSGTATYSGNPFVGVTPWANAYYASEVSSLAIPSLTGAMATAAAAVAKVPSFMWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANQDPAAQLFANVYKNASSPRAL...
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycoside hydrolase family 10 domain, Glycoside hydrolase superfamily, Glycoside hydrolase family 10. The designed protein sequence is
[ { "Beg": 50, "End": 343, "ID": "IPR001000", "Name": "Glycoside hydrolase family 10 domain", "Type": "Domain" }, { "Beg": 125, "End": 137, "ID": "IPR001000", "Name": "Glycoside hydrolase family 10 domain", "Type": "Domain" }, { "Beg": 168, "End": 179, "ID":...
MKANVILCLLAPLVAALPTETIHLDPELAALRANLTERTADLWDRQASQSIDQLIKRKGKLYFGTATDRGLLQREKNAAIIQADLGQVTPENSMKWQSLENNQGQLNWGDADYLVNFAQQNGKSIRGHTLIWHSQLPAWVNNINNADTLRQVIRTHVSTVVGRYKGKIRAWDVVNEIFNEDGTLRSSVFSRLLGEEFVSIAFRAARDADPSARLYINDYNLDRANYGKVNGLKTYVSKWISQGVPIDGIGSQSHLSGGGGSGTLGALQQLATVPVTELAITELDIQGAPTTDYTQVVQACLSVSKCVGITVWGISDKDSW...
Generate a protein sequence for a novel protein that integrates the following function keywords: GFO/IDH/MocA-like oxidoreductase domain, NAD(P)-binding domain superfamily, Gfo/Idh/MocA domain-containing protein, Gfo/Idh/MocA-like oxidoreductase, N-terminal. The designed protein sequence is
[ { "Beg": 11, "End": 137, "ID": "IPR000683", "Name": "Gfo/Idh/MocA-like oxidoreductase, N-terminal", "Type": "Domain" }, { "Beg": 8, "End": 166, "ID": "IPR036291", "Name": "NAD(P)-binding domain superfamily", "Type": "Homologous_superfamily" }, { "Beg": 3, "End...
MASGNPYTLKWGIMATGGIAETFCKDLLCNPAIRGADDVRHEIVAVASSSSSKRAEEFLQRIDGAFDAKTYGSYPELVADPNVDIVYVATPHSHHFQNTMLALEAGKNVLCEKAFTVTAAQARKLVETAKAKKLFLMEAVWTRYFPLSIKIRELIAAGEIGTVFRTIADLSINANSEQGQALKFADSHRMVNPDLAGGATLDLGVYPLTWVFQTLYHLQPEEDKEAPTVVASSNKYTTGADENTAIICSFPRHNSIGIASTTMRADTDPEKDTIPAVRIQGSKGEIQVFFPTYRPLKYKVVKTNGEAQTVDCPIPGDPAR...
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycoside hydrolase, family 7, Cellulose-binding domain superfamily, Glycoside hydrolase family 7, catalytic domain superfamily, Cellulose-binding domain, fungal, Concanavalin A-like lectin/glucanase domain superfamily. The...
[ { "Beg": 427, "End": 455, "ID": "IPR000254", "Name": "Cellulose-binding domain, fungal", "Type": "Domain" }, { "Beg": 431, "End": 458, "ID": "IPR000254", "Name": "Cellulose-binding domain, fungal", "Type": "Domain" }, { "Beg": 423, "End": 459, "ID": "IPR00...
MAPSVTLPLTTAILAIARLVAAQQPGTSTPEVHPKLTTYKCTKSGGCVAQDTSVVLDWNYRWMHDANYNSCTVNGGVNTTLCPDEATCGKNCFIEGVDYAASGVTTSGSSLTMNQYMPSSSGGYSSVSPRLYLLDSDGEYVMLKLNGQELSFDVDLSALPCGENGSLYLSQMDENGGANQYNTAGANYGSGYCDAQCPVQTWRNGTLNTSHQGFCCNEMDILEGNSRANALTPHSCTATACDSAGCGFNPYGSGYKSYYGPGDTVDTSKTFTIITQFNTDNGSPSGNLVSITRKYQQNGVDIPSAQPGGDTISSCPSASA...
Generate a protein sequence for a novel protein that integrates the following function keywords: Olfactory receptor, insect. The designed protein sequence is
[ { "Beg": 69, "End": 466, "ID": "IPR004117", "Name": "Olfactory receptor, insect", "Type": "Family" }, { "Beg": 21, "End": 477, "ID": "IPR004117", "Name": "Olfactory receptor, insect", "Type": "Family" } ]
MMKMKQQGLVADLLPNIRVMKTFGHFVFNYYNDNSSKYLHKVYCCVNLFMLLLQFGLCAVNLIVESADVDDLTANTITLLFFTHSIVKICYFAIRSKYFYRTWAIWNNPNSHPLFAESNARYHAIALKKMRLLLFLVGGTTMLAAVAWTVLTFFEHPIRKIVDPVTNETEIIELPQLLIRSFYPFDAGKGITHVLVLVYQFYWVLFMLIDANSLDVLFCSWLLFACEQLQHLKQIMKPLMELSATLDTVVPNSSELFKAGSADHLRDGDNPPPPPPPQSDNMLDLDLRNIYSNRQDFTATFRPTAGMTFNGGVGPNGLTK...
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycyl Radical Enzyme, Trans-4-hydroxy-L-proline dehydratase, Pyruvate formate lyase domain, Glycine radical domain. The designed protein sequence is
[ { "Beg": 668, "End": 771, "ID": "IPR001150", "Name": "Glycine radical domain", "Type": "Domain" }, { "Beg": 670, "End": 789, "ID": "IPR001150", "Name": "Glycine radical domain", "Type": "Domain" }, { "Beg": 7, "End": 652, "ID": "IPR004184", "Name": "Py...
MARGTFERTKKLREESINAEPHISIERAVLMTEAYKKYEGSVEIPVLRALSFKHYIENRTLSINDGELIVGEKGDSPNGAPTYPEICCHTMEDLEVMHNRDIINFSVSEEARKIHKEEIIPFWKKRQTRDKIINAMTPEWLAAYEAGMFTEFMEQRAPGHTVCGDTIYKKGFLDLKKDIEARLKELDFLNDLDAYNKKADLEAMAIACDAMVILGKRYAEKARQMAEEETDEAKKKDLLLIAETCDVVPAHKPETYHQAIQMYWFVHIGVTTELNIWDAFTPGRLDQHLNPFYERDVENGILDRDRAQELLECLWVKFNN...
Generate a protein sequence for a novel protein that integrates the following function keywords: Peptidase S8, pro-domain superfamily, Galactose-binding-like domain superfamily, Peptidase S8/S53 domain, Peptidase S8, subtilisin, Ser-active site, Peptidase S8, subtilisin-related, Peptidase S8, subtilisin, Asp-active sit...
[ { "Beg": 192, "End": 474, "ID": "IPR000209", "Name": "Peptidase S8/S53 domain", "Type": "Domain" }, { "Beg": 535, "End": 620, "ID": "IPR002884", "Name": "P domain", "Type": "Domain" }, { "Beg": 490, "End": 628, "ID": "IPR002884", "Name": "P domain", ...
MYWQLVRILVLFDCLQKILAIEHDSICIADVDDACPEPSHTVMRLRERNDKKAHLIAKQHGLEIRGQPFLDGKSYFVTHISKQRSRRRKREIISRLQEHPDILSIEEQRPRVRRKRDFLYPDIAHELAGSSTNIRHTGLISNTEPRIDFIQHDAPVLPFPDPLYKEQWYLNNGAQGGFDMNVQAAWLLGYAGRNISVSILDDGIQRDHPDLAANYDPLASTDINGHDDDPTPQDDGDNKHGTRCAGEVASIAGNVYCGVGVAFHAKIGGVRMLDGPVSDSVEAASLSLNRHHIDIYSASWGPEDDGRTFDGPGPLAREAF...
Generate a protein sequence for a novel protein that integrates the following function keywords: AAA+ ATPase domain, ATP-binding cassette transporter, PDR-like subfamily G, domain 1, ATP-binding cassette transporter, PDR-like subfamily G, domain 2, ABC transporter-like, conserved site, P-loop containing nucleoside trip...
[ { "Beg": 198, "End": 358, "ID": "IPR003439", "Name": "ABC transporter-like, ATP-binding domain", "Type": "Domain" }, { "Beg": 910, "End": 1061, "ID": "IPR003439", "Name": "ABC transporter-like, ATP-binding domain", "Type": "Domain" }, { "Beg": 167, "End": 432,...
MASQPPQPPSGQPDTQYEEYQSEVITETTNRPTPAADVYEITPTNDVMDDRYEHEHDDYESGAMYETVRTWSPQSRPELVRIASVFSRIDSHPDVAPTTEDGGQLNRRDTLAGVKIGDPVLDPTKPEFDFYKWARMFTHVMEKEGIKRNRTGVMFRNLTVLGSGSAVQYQDTFLSPFAAPFRPGELCGKGRNPEKVILHDFNGAIREGELLMVLGRPGSGCSTFLKAICGELHGLQKKKESIIHYNGVSQHTFKKELRGEAVYSAEDEHHFPHLTVGQTLEFAAAARTPSKRVLGLSRKDFSTHLARVMMSVFGLSHTYN...
Generate a protein sequence for a novel protein that integrates the following function keywords: Knottin, scorpion toxin-like superfamily, Defensin, invertebrate/fungal. The designed protein sequence is
[ { "Beg": 48, "End": 82, "ID": "IPR001542", "Name": "Defensin, invertebrate/fungal", "Type": "Domain" }, { "Beg": 48, "End": 84, "ID": "IPR001542", "Name": "Defensin, invertebrate/fungal", "Type": "Domain" }, { "Beg": 54, "End": 84, "ID": "IPR036574", "...
MQFTKLATVLIVSLMGSAAIAAPSVDNAPAVAAEEVAAAPAENLEKRGFGCPLNERECHSHCQSIGRKFGYCGGTLRLTCICGKE
Generate a protein sequence for a novel protein that integrates the following function keywords: AAA+ ATPase domain, ABC transporter type 1, transmembrane domain superfamily, ABC transporter type 1, transmembrane domain, P-loop containing nucleoside triphosphate hydrolase, ABC transporter-like, ATP-binding domain, Type...
[ { "Beg": 441, "End": 598, "ID": "IPR003439", "Name": "ABC transporter-like, ATP-binding domain", "Type": "Domain" }, { "Beg": 1104, "End": 1255, "ID": "IPR003439", "Name": "ABC transporter-like, ATP-binding domain", "Type": "Domain" }, { "Beg": 422, "End": 667...
MVEVSEKPNTQDDGVSKQENRNPASSSSSTSDKEKVAKKGNSDATKSSTPEDLDAQLAHLPEHEREILKQQLFIPDAKATYGTLFRYATRNDMIFLAIVSLASIAAGAALPLFTVLFGSLAGTFRDIALHRITYDEFNSILTRNSLYFVYLGIAQFILLYVSTVGFIYVGEHITQKIRAKYLHAILRQNIGFFDKLGAGEVTTRITADTNLIQDGISEKVGLTLTALSTFFSAFIIGYVRYWKLALICSSTIVAMILVMGGISRFVVKSGRMTLVSYGEGGTVAEEVISSIRNATAFGTQEKLARQYEVHLKEARKWGRR...
Generate a protein sequence for a novel protein that integrates the following function keywords: AAA+ ATPase domain, ABC transporter type 1, transmembrane domain superfamily, ABC transporter type 1, transmembrane domain, P-loop containing nucleoside triphosphate hydrolase, ABC transporter-like, ATP-binding domain, Type...
[ { "Beg": 421, "End": 613, "ID": "IPR003439", "Name": "ABC transporter-like, ATP-binding domain", "Type": "Domain" }, { "Beg": 1153, "End": 1305, "ID": "IPR003439", "Name": "ABC transporter-like, ATP-binding domain", "Type": "Domain" }, { "Beg": 403, "End": 682...
MAVEEKNSPTGAAMTNTGILVPSSQQSLPEWWTKTQKFFSRENTITPTFGYFRLLFGTQPGKTDIALIVIGTIAGIGAGIPFPLLGILFGELVDDLNSSTCSTTQAPPGGYQAAITTKVLQVIYVSILNFVCMYIHTGCWSMVGERLVRRLRTKYFHSLLRQEIAFTDTLPSGDVTSRLVSDIEVIQAGTSEKVGLFIGTISYFVAAYIVAFLKVATIAAMLMSVVPIYFLMAFGGGHYIKKYSGRISTHINAATSIVSSSLSHMSIVHAFNANARLEALFAQHLVSARMDALKKAITHSIQFGMLYFVAYASNALAFWQ...
Generate a protein sequence for a novel protein that integrates the following function keywords: Spider toxin CSTX, Knottin scaffold, Spider toxin CSTX, Knottin scaffold conserved site. The designed protein sequence is
[ { "Beg": 51, "End": 77, "ID": "IPR011142", "Name": "Spider toxin CSTX, Knottin scaffold conserved site", "Type": "Conserved_site" }, { "Beg": 115, "End": 141, "ID": "IPR011142", "Name": "Spider toxin CSTX, Knottin scaffold conserved site", "Type": "Conserved_site" }, ...
MKFSLFFGVLFLAILHSCLSESEKDLTDEDHFRSSDSFLSEIQEESRGKKCIERNKECTNDRHGCCRGKIFKDKCECVGSGGKERCVCKQKKWAKIIESYIGDIPTLPKPEDDKCVPKHEDCSERKNDCCKSGLFTLKCKCYDMQDDEDGKKTELCGCVQPFEHKAIEQALRFGKWMVG
Generate a protein sequence for a novel protein that integrates the following function keywords: NAD-dependent epimerase/dehydratase, NAD(P)-dependent dehydratase-like, NAD(P)-binding domain superfamily. The designed protein sequence is
[ { "Beg": 9, "End": 241, "ID": "IPR001509", "Name": "NAD-dependent epimerase/dehydratase", "Type": "Domain" }, { "Beg": 2, "End": 313, "ID": "IPR036291", "Name": "NAD(P)-binding domain superfamily", "Type": "Homologous_superfamily" }, { "Beg": 8, "End": 305, ...
MRSVSGQVVCVTGAGGFIASWLVKILLEKGYTVRGTVRNPDDPKNGHLRELEGAKERLTLCKADLLDYQSLREAINGCDGVFHTASPVTDDPEQMVEPAVIGTKNVINAAAEANVRRVVFTSSIGAVYMDPNRDPETVVDETCWSDPDFCKNTKNWYCYGKMVAEQAAWEEAKEKGVDLVVINPVLVQGPLLQTTVNASVLHILKYLTGSAKTYANSVQAYVDVKDVALAHILLYETPEASGRYLCAESVLHRGDVVEILSKFFPEYPIPTKCSDVTKPRVKPYKFSNQKLKDLGLEFTPVKQCLYETVKSLQEKGHLPI...
Generate a protein sequence for a novel protein that integrates the following function keywords: Knottin, scorpion toxin-like superfamily. The designed protein sequence is
[ { "Beg": 24, "End": 54, "ID": "IPR036574", "Name": "Knottin, scorpion toxin-like superfamily", "Type": "Homologous_superfamily" } ]
MKIFFAILLILAVCSMAIWTVNGTPFAIRCKTDSDCSYKCPGNPPCRNGFCKCT
Generate a protein sequence for a novel protein that integrates the following function keywords: Scorpion short chain toxin, potassium channel inhibitor, Knottin, scorpion toxin-like superfamily. The designed protein sequence is
[ { "Beg": 32, "End": 62, "ID": "IPR001947", "Name": "Scorpion short chain toxin, potassium channel inhibitor", "Type": "Family" }, { "Beg": 25, "End": 62, "ID": "IPR036574", "Name": "Knottin, scorpion toxin-like superfamily", "Type": "Homologous_superfamily" }, { "...
MKFLFLTLVLLYFTAILVFIVFPSYAQIQTNASCTTSTHCVEPCRKRCLLIHKCINDKCTCYPRINICEKKNN
Generate a protein sequence for a novel protein that integrates the following function keywords: Knottin, scorpion toxin-like superfamily. The designed protein sequence is
[ { "Beg": 25, "End": 56, "ID": "IPR036574", "Name": "Knottin, scorpion toxin-like superfamily", "Type": "Homologous_superfamily" } ]
MSGLSVFILIALVLSVIIDVLNNSKVEAACKENCRQYCQAKGARNGKCINSNCKCYY
Generate a protein sequence for a novel protein that integrates the following function keywords: Long chain scorpion toxin, cysteine-stabilized alpha/beta domain. The designed protein sequence is
[ { "Beg": 38, "End": 86, "ID": "IPR029237", "Name": "Long chain scorpion toxin, cysteine-stabilized alpha/beta domain", "Type": "Domain" }, { "Beg": 54, "End": 91, "ID": "IPR029237", "Name": "Long chain scorpion toxin, cysteine-stabilized alpha/beta domain", "Type": "Domai...
MQRNLVVLLFLGMVALSSCGLREKHFQKLVKYAVPEGTLRTIIQTAVHKLGKTQFGCPAYQGYCDDHCQDIKKQEGFCHGFKCKCGIPMGF
Generate a protein sequence for a novel protein that integrates the following function keywords: Pyruvate phosphate dikinase, AMP/ATP-binding, Phosphoenolpyruvate Utilizing Enzyme, PEP-utilising enzyme, mobile domain, ATP-grasp fold, subdomain 1, Phosphohistidine domain superfamily. The designed protein sequence is
[ { "Beg": 19, "End": 316, "ID": "IPR002192", "Name": "Pyruvate phosphate dikinase, AMP/ATP-binding", "Type": "Domain" }, { "Beg": 789, "End": 859, "ID": "IPR008279", "Name": "PEP-utilising enzyme, mobile domain", "Type": "Domain" }, { "Beg": 1, "End": 185, ...
MSGRLVVDLQDVDAAGLAEVGGKGAHLGELSRIDGVRVPSGFCVTTHAFRRIMAEAPESGELLDRLSRVDEGDQEAVRSLAARLRQVVGATPLPDEVAAAVTGALARHGERSAYAVRSSATAEDLPTASFAGQQDTYLNVVGTEEILRHVSRCWASLFTERAVTYRGRQGVDHRTVHMGVVVQRMVVPRASGILFTADPVTGDRRTATVDAGFGLGEALVSGLVDPDVLTVRHGEVVARTIAAKRRALHAVQGGGTRETPIEERRQREPVLTDDQAVELVALGRRIEAHFGSPQDIEWCLDDDGFHIVQSRPITTLFPVP...
Generate a protein sequence for a novel protein that integrates the following function keywords: Vanillate O-demethylase oxygenase-like, C-terminal catalytic domain, Rieske [2Fe-2S] iron-sulphur domain superfamily, Cholesterol 7-desaturase, Rieske [2Fe-2S] iron-sulphur domain. The designed protein sequence is
[ { "Beg": 7, "End": 86, "ID": "IPR017941", "Name": "Rieske [2Fe-2S] iron-sulphur domain", "Type": "Domain" }, { "Beg": 7, "End": 108, "ID": "IPR017941", "Name": "Rieske [2Fe-2S] iron-sulphur domain", "Type": "Domain" }, { "Beg": 1, "End": 123, "ID": "IPR036...
MFLQNAWYAVAWCDEVTDGIVTRKVLGRELALFRDGEGQPRAILNRCPHRFAPLSLGKRIGDAIQCPYHGLHFGPDGRCVHNPHGDGVVPDVATPTFPARERHKLIWAWMGDPALATDDIAGGEYGYLDDVELDLLPRGHLHLDCDYRLVIDNLMDPAHVAVLHDSALASEALIRAVPRVWREEDVIRVESWAPDSKPSFLFGAWLGNHDDPVDHWVASRWQAAGLLSVEGGVVAVGGDREDGLRVRGAHMITPETETSAHYFWAVVRNFREDDAEQSEQIRATTAAIFTGEDKWMLEAIERSMDGEEFWSLRPAILGTD...
Generate a protein sequence for a novel protein that integrates the following function keywords: Flavin-dependent aromatic-ring hydroxylase, FAD-binding domain, FAD/NAD(P)-binding domain superfamily. The designed protein sequence is
[ { "Beg": 6, "End": 316, "ID": "IPR002938", "Name": "FAD-binding domain", "Type": "Domain" }, { "Beg": 9, "End": 342, "ID": "IPR036188", "Name": "FAD/NAD(P)-binding domain superfamily", "Type": "Homologous_superfamily" }, { "Beg": 5, "End": 356, "ID": "IPR0...
MTKHIKILVIGVGVAGPAVAYWLKRFGFSPVLIEKSAAVRKGGQALDIRGIATHIAKEMGIYDQICNMRTQIKCGRYVDVKGNVLHEEQGETFGFRQDDEVEILRGDLVEILMKAIADIPCEFKQSVIKIEQNEDSVTVTYKDGRVENYDLVIAADGIHSATRGMVFSKNEYQLINLGSYVSAFTIPNYLGLDHMELLCESNHKLVTLQSDSQADKAMAGFMFRSKHVLEDIRDEQEQKHFLHASFQNFGWETQNILNRMPESDDFYFDAITQIKMKSWTKGRIALIGDAAYCPSPLSGQGNNLAFVGAYILAGELKKAD...
Generate a protein sequence for a novel protein that integrates the following function keywords: Chloroquine-resistance transporter-like. The designed protein sequence is
[ { "Beg": 357, "End": 688, "ID": "IPR013936", "Name": "Chloroquine-resistance transporter-like", "Type": "Family" }, { "Beg": 349, "End": 696, "ID": "IPR013936", "Name": "Chloroquine-resistance transporter-like", "Type": "Family" } ]
MPPAHHGSGGRRRPGRGNKGKRDTEAGMTASPDPGYMRPETHAAPSQQTDVRSPASAREHRNADVGVAAPDALTPNAGEQKEVEGVAKVNVAVSSDQPPDWAPSQSDLPPSLSPTTASRPATSSRSPRARSRHSPVASSSAFSSPAPSASALTSASGVPEAPLAAPELKHTLAADEGNPEPRLEGPVERLHARQENPLTDSSDGSYILLEEGESQRACLDRKNRHLRQTTPPGVWTTADLASQNSHSASFASGFRRALLPSGGSGDHDEQASDCRASLRGMQRPCFGSPSTDTRMGAAEGLPLASRRRRQHWRRELRAFG...
Generate a protein sequence for a novel protein that integrates the following function keywords: HphA, C-terminal domain, Outer membrane protein/outer membrane enzyme PagP, beta-barrel, Slam-dependent hemophilin, C-terminal domain, HphA, N-terminal heme-binding domain. The designed protein sequence is
[ { "Beg": 111, "End": 262, "ID": "IPR011250", "Name": "Outer membrane protein/outer membrane enzyme PagP, beta-barrel", "Type": "Homologous_superfamily" }, { "Beg": 21, "End": 133, "ID": "IPR054535", "Name": "HphA, N-terminal heme-binding domain", "Type": "Domain" }, {...
MKISQLFLGLVACSTAFAYAGIDGISSNESNIKIGAAANASHPGGVAAVSVQAAGAPYNAFTGFSSLKGLAQAFAAQGTSNTNVTVGSKTFNISHIPVSAMPPSHSALGNFNFGQVGTQEVYFGEWWKAGDTPASASHTVYYAGDNTNTTVPTAGTATYTVAGINGSASNLLSGTFTANYGAGTLEGTLTGTGTAVSSLSLDGVAFNPGTAAFAGLATANGTAGVDNSGVVQGQFFGANASALAGIAQFDNVSYNTAFGGAKN
Generate a protein sequence for a novel protein that integrates the following function keywords: Glycosyl transferase, family 1, Sucrose synthase, N-terminal, Sucrose synthase, plant/cyanobacteria, Sucrose synthase, EPBD domain, Sucrose synthase, first GT-B domain. The designed protein sequence is
[ { "Beg": 253, "End": 542, "ID": "IPR000368", "Name": "Sucrose synthase, first GT-B domain", "Type": "Domain" }, { "Beg": 550, "End": 722, "ID": "IPR001296", "Name": "Glycosyl transferase, family 1", "Type": "Domain" }, { "Beg": 56, "End": 792, "ID": "IPR01...
MIEALRQQLLDDPRSWYAFLRHLVASQRDSWLYTDLQRACADFREQLPEGYAEGIGPLEDFVAHTQEVIFRDPWMVFAWRPRPGRWIYVRIHREQLALEELSTDAYLQAKEGIVGLGAEGEAVLTVDFRDFRPVSRRLRDESTIGDGLTHLNRRLAGRIFSDLAAGRSQILEFLSLHRLDGQNLMLSNGNTDFDSLRQTVQYLGTLPRETPWAEIREDMRRRGFAPGWGNTAGRVRETMRLLMDLLDSPSPAALESFLDRIPMISRILIVSIHGWFAQDKVLGRPDTGGQVVYILDQARALEREMRNRLRQQGVDVEPRI...