Entry_x string | Sequence string | length int64 | mol_weight float64 | iso_point float64 | aromaticity float64 | instability_index float64 | gravy float64 | helix_frac float64 | turn_frac float64 | sheet_frac float64 | count_A int64 | percent_A float64 | count_C int64 | percent_C float64 | count_D int64 | percent_D float64 | count_E int64 | percent_E float64 | count_F int64 | percent_F float64 | count_G int64 | percent_G float64 | count_H int64 | percent_H float64 | count_I int64 | percent_I float64 | count_K int64 | percent_K float64 | count_L int64 | percent_L float64 | count_M int64 | percent_M float64 | count_N int64 | percent_N float64 | count_P int64 | percent_P float64 | count_Q int64 | percent_Q float64 | count_R int64 | percent_R float64 | count_S int64 | percent_S float64 | count_T int64 | percent_T float64 | count_V int64 | percent_V float64 | count_W int64 | percent_W float64 | count_Y int64 | percent_Y float64 | charge_pH7 int64 | boman_index float64 | aliphatic_index float64 | hydrophobic_moment float64 | Entry_y string | Entry Name string | Protein names string | Organism string | Length int64 | Mass int64 | Subcellular location [CC] string | Gene Ontology (biological process) string | Gene Ontology (molecular function) string | EC number string | Disruption phenotype string | Catalytic activity string | Pathway string | Subcellular location [CC].1 string | Function [CC] string | Domain [CC] string | Induction string | Disruption phenotype.1 string |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
P55036 | MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPA... | 377 | 40,736.2143 | 4.682248 | 0.034483 | 45.759151 | -0.457029 | 0.381963 | 0.30504 | 0.291777 | 38 | 0.101 | 4 | 0.011 | 28 | 0.074 | 35 | 0.093 | 10 | 0.027 | 27 | 0.072 | 6 | 0.016 | 16 | 0.042 | 24 | 0.064 | 34 | 0.09 | 13 | 0.034 | 18 | 0.048 | 16 | 0.042 | 17 | 0.045 | 15 | 0.04 | 26 | 0.069 | 24 | 0.064 | 23 | 0.061 | 0 | 0 | 3 | 0.008 | 377 | 40,735.36 | -23.369 | -0.000574 | P55036 | PSMD4_HUMAN | 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Antisecretory factor 1) (AF) (ASF) (Multiubiquitin chain-binding protein) | Homo sapiens (Human) | 377 | 40,737 | nan | proteasome-mediated ubiquitin-dependent protein catabolic process [GO:0043161] | identical protein binding [GO:0042802]; molecular adaptor activity [GO:0060090]; polyubiquitin modification-dependent protein binding [GO:0031593]; RNA binding [GO:0003723] | nan | nan | nan | nan | nan | FUNCTION: Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose ... | DOMAIN: The 2 UIM motifs are involved in the binding to a multi-ubiquitin chain in a cooperative way. {ECO:0000269|PubMed:15826667, ECO:0000269|PubMed:19683493}. | nan | nan |
P54920 | MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSAAGNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIAEIYETELVDIEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQKAIDIYEQVGTNAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIKKTIQGDEEDLR | 295 | 33,232.3678 | 5.228699 | 0.098305 | 47.337966 | -0.347458 | 0.444068 | 0.216949 | 0.301695 | 41 | 0.139 | 8 | 0.027 | 17 | 0.058 | 28 | 0.095 | 13 | 0.044 | 11 | 0.037 | 7 | 0.024 | 17 | 0.058 | 26 | 0.088 | 26 | 0.088 | 10 | 0.034 | 12 | 0.041 | 3 | 0.01 | 14 | 0.047 | 8 | 0.027 | 21 | 0.071 | 9 | 0.031 | 8 | 0.027 | 2 | 0.007 | 14 | 0.047 | 295 | 33,231.49 | -10.972 | -0.00033 | P54920 | SNAA_HUMAN | Alpha-soluble NSF attachment protein (SNAP-alpha) (N-ethylmaleimide-sensitive factor attachment protein alpha) | Homo sapiens (Human) | 295 | 33,233 | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:15980433}; Peripheral membrane protein {ECO:0000305|PubMed:15029241}. | apical protein localization [GO:0045176]; brain development [GO:0007420]; intra-Golgi vesicle-mediated transport [GO:0006891]; intracellular protein transport [GO:0006886]; membrane fusion [GO:0061025]; neuron differentiation [GO:0030182]; regulation of synaptic vesicle priming [GO:0010807]; SNARE complex disassembly [... | protein-containing complex binding [GO:0044877]; SNARE binding [GO:0000149]; soluble NSF attachment protein activity [GO:0005483]; syntaxin binding [GO:0019905] | nan | nan | nan | nan | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:15980433}; Peripheral membrane protein {ECO:0000305|PubMed:15029241}. | FUNCTION: Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus (Probable). Together with GNA12 promotes CDH5 localization to plasma membrane (PubMed:15980433). {ECO:0000269|PubMed:15980433, ECO:0000305}. | nan | nan | nan |
P55263 | MAAAEEEPKPKKLKVEAPQALRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKARVCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFV... | 362 | 40,544.9599 | 6.236909 | 0.088398 | 39.473508 | -0.317956 | 0.378453 | 0.234807 | 0.337017 | 39 | 0.108 | 7 | 0.019 | 21 | 0.058 | 29 | 0.08 | 21 | 0.058 | 19 | 0.052 | 10 | 0.028 | 25 | 0.069 | 34 | 0.094 | 27 | 0.075 | 8 | 0.022 | 15 | 0.041 | 14 | 0.039 | 16 | 0.044 | 12 | 0.033 | 16 | 0.044 | 19 | 0.052 | 19 | 0.052 | 2 | 0.006 | 9 | 0.025 | 362 | 40,544.11 | -3.686 | -0.000091 | P55263 | ADK_HUMAN | Adenosine kinase (AK) (EC 2.7.1.20) (Adenosine 5'-phosphotransferase) | Homo sapiens (Human) | 362 | 40,545 | SUBCELLULAR LOCATION: [Isoform 1]: Nucleus {ECO:0000269|PubMed:19635462}.; SUBCELLULAR LOCATION: [Isoform 2]: Cytoplasm {ECO:0000269|PubMed:19635462}. | AMP salvage [GO:0044209]; dAMP salvage [GO:0106383]; dATP biosynthetic process [GO:0006175]; GMP salvage [GO:0032263]; purine nucleobase metabolic process [GO:0006144]; purine ribonucleoside salvage [GO:0006166]; ribonucleoside monophosphate biosynthetic process [GO:0009156] | adenosine kinase activity [GO:0004001]; ATP binding [GO:0005524]; deoxyadenosine kinase activity [GO:0004136]; metal ion binding [GO:0046872]; RNA binding [GO:0003723] | 2.7.1.20 | nan | CATALYTIC ACTIVITY: Reaction=adenosine + ATP = AMP + ADP + H(+); Xref=Rhea:RHEA:20824, ChEBI:CHEBI:15378, ChEBI:CHEBI:16335, ChEBI:CHEBI:30616, ChEBI:CHEBI:456215, ChEBI:CHEBI:456216; EC=2.7.1.20; Evidence={ECO:0000269|PubMed:21963049, ECO:0000269|PubMed:8577746, ECO:0000269|PubMed:9070863}; PhysiologicalDirection=left... | PATHWAY: Purine metabolism; AMP biosynthesis via salvage pathway; AMP from adenosine: step 1/1. | SUBCELLULAR LOCATION: [Isoform 1]: Nucleus {ECO:0000269|PubMed:19635462}.; SUBCELLULAR LOCATION: [Isoform 2]: Cytoplasm {ECO:0000269|PubMed:19635462}. | FUNCTION: Catalyzes the phosphorylation of the purine nucleoside adenosine at the 5' position in an ATP-dependent manner. Serves as a potential regulator of concentrations of extracellular adenosine and intracellular adenine nucleotides. {ECO:0000269|PubMed:21963049, ECO:0000269|PubMed:8577746, ECO:0000269|PubMed:90708... | nan | nan | nan |
P54855 | MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIHMLYFDFWFQIYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEE... | 530 | 61,035.6172 | 8.976916 | 0.128302 | 33.589075 | -0.043208 | 0.341509 | 0.258491 | 0.407547 | 29 | 0.055 | 9 | 0.017 | 23 | 0.043 | 27 | 0.051 | 33 | 0.062 | 27 | 0.051 | 15 | 0.028 | 32 | 0.06 | 44 | 0.083 | 60 | 0.113 | 21 | 0.04 | 23 | 0.043 | 23 | 0.043 | 15 | 0.028 | 17 | 0.032 | 41 | 0.077 | 23 | 0.043 | 33 | 0.062 | 14 | 0.026 | 21 | 0.04 | 530 | 61,034.84 | 11.186 | 0.000183 | P54855 | UDB15_HUMAN | UDP-glucuronosyltransferase 2B15 (UDPGT 2B15) (UGT2B15) (EC 2.4.1.17) (HLUG4) (UDP-glucuronosyltransferase 2B8) (UDPGT 2B8) (UDPGTh-3) | Homo sapiens (Human) | 530 | 61,036 | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000305|PubMed:23288867}; Single-pass membrane protein {ECO:0000255}. | estrogen metabolic process [GO:0008210]; steroid metabolic process [GO:0008202]; xenobiotic metabolic process [GO:0006805] | glucuronosyltransferase activity [GO:0015020] | 2.4.1.17 | nan | CATALYTIC ACTIVITY: Reaction=glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + UDP + H(+); Xref=Rhea:RHEA:21032, ChEBI:CHEBI:15378, ChEBI:CHEBI:58052, ChEBI:CHEBI:58223, ChEBI:CHEBI:132367, ChEBI:CHEBI:132368; EC=2.4.1.17; Evidence={ECO:0000269|PubMed:16595710, ECO:0000269|PubMed:18719240... | nan | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000305|PubMed:23288867}; Single-pass membrane protein {ECO:0000255}. | FUNCTION: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:16595710, PubMed:18719240, PubMed:2328886... | nan | nan | nan |
P54840 | MLRGRSLSVTSLGGLPQWEVEELPVEELLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWGENYFLIGPYFEHNMKTQVEQCEPVNDAVRRAVDAMNKHGCQVHFGRWLIEGSPYVVLFDIGYSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFLKEVTDHADGKYVVAQFHEWQAGIGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYHRYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMYKARIQDFVRGHFYGHLDFDL... | 703 | 80,988.1014 | 6.348483 | 0.113798 | 43.977838 | -0.39431 | 0.291607 | 0.268848 | 0.378378 | 40 | 0.057 | 11 | 0.016 | 43 | 0.061 | 49 | 0.07 | 40 | 0.057 | 41 | 0.058 | 28 | 0.04 | 36 | 0.051 | 37 | 0.053 | 64 | 0.091 | 15 | 0.021 | 27 | 0.038 | 34 | 0.048 | 22 | 0.031 | 46 | 0.065 | 44 | 0.063 | 40 | 0.057 | 46 | 0.065 | 12 | 0.017 | 28 | 0.04 | 703 | 80,987.36 | -8.573 | -0.000106 | P54840 | GYS2_HUMAN | Glycogen [starch] synthase, liver (EC 2.4.1.11) (Glycogen synthase 2) | Homo sapiens (Human) | 703 | 80,989 | nan | glycogen biosynthetic process [GO:0005978]; response to glucose [GO:0009749] | alpha-1,4-glucan glucosyltransferase (UDP-glucose donor) activity [GO:0004373]; glycogen synthase activity, transferring glucose-1-phosphate [GO:0061547] | 2.4.1.11 | nan | CATALYTIC ACTIVITY: Reaction=[(1->4)-alpha-D-glucosyl](n) + UDP-alpha-D-glucose = [(1->4)-alpha-D-glucosyl](n+1) + UDP + H(+); Xref=Rhea:RHEA:18549, Rhea:RHEA-COMP:9584, Rhea:RHEA-COMP:9587, ChEBI:CHEBI:15378, ChEBI:CHEBI:15444, ChEBI:CHEBI:58223, ChEBI:CHEBI:58885; EC=2.4.1.11; Evidence={ECO:0000269|PubMed:1731614, EC... | PATHWAY: Glycan biosynthesis; glycogen biosynthesis. {ECO:0000269|PubMed:1731614, ECO:0000269|PubMed:9691087}. | nan | FUNCTION: Glycogen synthase participates in the glycogen biosynthetic process along with glycogenin and glycogen branching enzyme. Extends the primer composed of a few glucose units formed by glycogenin by adding new glucose units to it. In this context, glycogen synthase transfers the glycosyl residue from UDP-Glc to ... | nan | nan | nan |
P54802 | MEAVAVAAAVGVLLLAGAGGAAGDEAREAAAVRALVARLLGPGPAADFSVSVERALAAKPGLDTYSLGGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWSGSQLRLPRPLPAVPGELTEATPNRYRYYQNVCTQSYSFVWWDWARWEREIDWMALNGINLALAWSGQEAIWQRVYLALGLTQAEINEFFTGPAFLAWGRMGNLHTWDGPLPPSWHIKQLYLQHRVLDQMRSFGMTPVLPAFAGHVPEAVTRVFPQVNVTKMGSWGHFNCSYSCSFLLAPEDPIFPIIGSLFLRELIKEFGTDHIYGADTFNEMQPP... | 743 | 82,264.661 | 6.19985 | 0.121131 | 40.981575 | -0.038627 | 0.332436 | 0.271871 | 0.370121 | 95 | 0.128 | 8 | 0.011 | 27 | 0.036 | 40 | 0.054 | 34 | 0.046 | 60 | 0.081 | 14 | 0.019 | 17 | 0.023 | 12 | 0.016 | 87 | 0.117 | 13 | 0.017 | 23 | 0.031 | 44 | 0.059 | 35 | 0.047 | 49 | 0.066 | 48 | 0.065 | 29 | 0.039 | 52 | 0.07 | 26 | 0.035 | 30 | 0.04 | 743 | 82,263.92 | -5.696 | -0.000069 | P54802 | ANAG_HUMAN | Alpha-N-acetylglucosaminidase (EC 3.2.1.50) (N-acetyl-alpha-glucosaminidase) (NAG) [Cleaved into: Alpha-N-acetylglucosaminidase 82 kDa form; Alpha-N-acetylglucosaminidase 77 kDa form] | Homo sapiens (Human) | 743 | 82,266 | SUBCELLULAR LOCATION: Lysosome. | adult behavior [GO:0030534]; amyloid precursor protein metabolic process [GO:0042982]; aorta morphogenesis [GO:0035909]; astrocyte activation [GO:0048143]; autophagy [GO:0006914]; cardiac muscle cell development [GO:0055013]; cell surface receptor signaling pathway via STAT [GO:0097696]; cellular response to oxidative ... | alpha-N-acetylglucosaminidase activity [GO:0004561] | 3.2.1.50 | nan | CATALYTIC ACTIVITY: Reaction=Hydrolysis of terminal non-reducing N-acetyl-D-glucosamine residues in N-acetyl-alpha-D-glucosaminides.; EC=3.2.1.50; | nan | SUBCELLULAR LOCATION: Lysosome. | FUNCTION: Involved in the degradation of heparan sulfate. | nan | nan | nan |
P54821 | MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSATCANNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN | 245 | 27,296.0834 | 9.48151 | 0.061224 | 54.882449 | -0.790204 | 0.326531 | 0.318367 | 0.281633 | 26 | 0.106 | 1 | 0.004 | 12 | 0.049 | 15 | 0.061 | 6 | 0.024 | 12 | 0.049 | 3 | 0.012 | 3 | 0.012 | 11 | 0.045 | 23 | 0.094 | 5 | 0.02 | 19 | 0.078 | 13 | 0.053 | 15 | 0.061 | 22 | 0.09 | 22 | 0.09 | 14 | 0.057 | 14 | 0.057 | 2 | 0.008 | 7 | 0.029 | 245 | 27,295.18 | 6.952 | 0.000255 | P54821 | PRRX1_HUMAN | Paired mesoderm homeobox protein 1 (Homeobox protein PHOX1) (Paired-related homeobox protein 1) (PRX-1) | Homo sapiens (Human) | 245 | 27,296 | SUBCELLULAR LOCATION: Nucleus {ECO:0000250|UniProtKB:P63013}. | artery morphogenesis [GO:0048844]; cartilage development [GO:0051216]; embryonic cranial skeleton morphogenesis [GO:0048701]; embryonic limb morphogenesis [GO:0030326]; inner ear morphogenesis [GO:0042472]; mesenchymal cell proliferation [GO:0010463]; middle ear morphogenesis [GO:0042474]; neuron fate determination [GO... | DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; HMG box domain binding [GO:0071837]; RNA polymerase II cis-reg... | nan | nan | nan | nan | SUBCELLULAR LOCATION: Nucleus {ECO:0000250|UniProtKB:P63013}. | FUNCTION: Master transcription factor of stromal fibroblasts for myofibroblastic lineage progression. Orchestrates the functional drift of fibroblasts into myofibroblastic phenotype via TGF-beta signaling by remodeling a super-enhancer landscape. Through this function, plays an essential role in wound healing process (... | nan | nan | nan |
P54710 | MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP | 66 | 7,283.2441 | 7.8845 | 0.106061 | 67.080455 | -0.292424 | 0.257576 | 0.378788 | 0.348485 | 2 | 0.03 | 1 | 0.015 | 5 | 0.076 | 3 | 0.045 | 4 | 0.061 | 11 | 0.167 | 0 | 0 | 4 | 0.061 | 3 | 0.045 | 7 | 0.106 | 2 | 0.03 | 3 | 0.045 | 3 | 0.045 | 1 | 0.015 | 6 | 0.091 | 3 | 0.045 | 2 | 0.03 | 3 | 0.045 | 0 | 0 | 3 | 0.045 | 66 | 7,282.29 | 1.831 | 0.000251 | P54710 | ATNG_HUMAN | Sodium/potassium-transporting ATPase subunit gamma (Na(+)/K(+) ATPase subunit gamma) (FXYD domain-containing ion transport regulator 2) (Sodium pump gamma chain) | Homo sapiens (Human) | 66 | 7,283 | SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Single-pass type III membrane protein {ECO:0000305}. | cellular hyperosmotic salinity response [GO:0071475]; establishment or maintenance of transmembrane electrochemical gradient [GO:0010248]; intracellular potassium ion homeostasis [GO:0030007]; intracellular sodium ion homeostasis [GO:0006883]; negative regulation of cell population proliferation [GO:0008285]; positive ... | ATPase activator activity [GO:0001671]; protein-macromolecule adaptor activity [GO:0030674]; sodium channel regulator activity [GO:0017080] | nan | nan | nan | nan | SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Single-pass type III membrane protein {ECO:0000305}. | FUNCTION: May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase. | nan | nan | nan |
P55259 | MPHLMERMVGSGLLWLALVSCILTQASAVQRGYGNPIEASSYGLDLDCGAPGTPEAHVCFDPCQNYTLLDEPFRSTENSAGSQGCDKNMSGWYRFVGEGGVRMSETCVQVHRCQTDAPMWLNGTHPALGDGITNHTACAHWSGNCCFWKTEVLVKACPGGYHVYRLEGTPWCNLRYCTVPRDPSTVEDKCEKACRPEEECLALNSTWGCFCRQDLNSSDVHSLQPQLDCGPREIKVKVDKCLLGGLGLGEEVIAYLRDPNCSSILQTEERNWVSVTSPVQASACRNILERNQTHAIYKNTLSLVNDFIIRDTILNINFQC... | 537 | 59,479.9005 | 5.081372 | 0.080074 | 47.770577 | -0.143762 | 0.266294 | 0.307263 | 0.350093 | 33 | 0.061 | 29 | 0.054 | 28 | 0.052 | 32 | 0.06 | 17 | 0.032 | 38 | 0.071 | 13 | 0.024 | 21 | 0.039 | 12 | 0.022 | 54 | 0.101 | 12 | 0.022 | 29 | 0.054 | 27 | 0.05 | 25 | 0.047 | 28 | 0.052 | 43 | 0.08 | 28 | 0.052 | 42 | 0.078 | 10 | 0.019 | 16 | 0.03 | 537 | 59,479.1 | -22.946 | -0.000386 | P55259 | GP2_HUMAN | Pancreatic secretory granule membrane major glycoprotein GP2 (Pancreatic zymogen granule membrane protein GP-2) (ZAP75) | Homo sapiens (Human) | 537 | 59,480 | SUBCELLULAR LOCATION: Zymogen granule membrane {ECO:0000250|UniProtKB:P19218}; Lipid-anchor, GPI-anchor {ECO:0000250|UniProtKB:P19218}. Secreted {ECO:0000269|PubMed:10760606}. Cell membrane {ECO:0000250|UniProtKB:P19218}; Lipid-anchor, GPI-anchor {ECO:0000250|UniProtKB:P19218}. Apical cell membrane {ECO:0000250|UniProt... | antigen transcytosis by M cells in mucosal-associated lymphoid tissue [GO:0002412]; innate immune response [GO:0045087]; neutrophil migration [GO:1990266] | antigen binding [GO:0003823] | nan | nan | nan | nan | SUBCELLULAR LOCATION: Zymogen granule membrane {ECO:0000250|UniProtKB:P19218}; Lipid-anchor, GPI-anchor {ECO:0000250|UniProtKB:P19218}. Secreted {ECO:0000269|PubMed:10760606}. Cell membrane {ECO:0000250|UniProtKB:P19218}; Lipid-anchor, GPI-anchor {ECO:0000250|UniProtKB:P19218}. Apical cell membrane {ECO:0000250|UniProt... | FUNCTION: Functions as an intestinal M-cell transcytotic receptor specific for type-I-piliated bacteria that participates in the mucosal immune response toward these bacteria. At the apical membrane of M-cells it binds fimH, a protein of the bacteria type I pilus tip. Internalizes bound bacteria, like E.coli and S.typh... | DOMAIN: Each ZP domain consists of an N-terminal (ZP-N) and C-terminal (ZP-C) region connected by a flexible linker; the linker allows the ZP domain to wrap around the ZP-C subdomain of the preceding subunit. {ECO:0000250|UniProtKB:P07911}. | nan | nan |
P54315 | MLIFWTITLFLLGAAKGKEVCYEDLGCFSDTEPWGGTAIRPLKILPWSPEKIGTRFLLYTNENPNNFQILLLSDPSTIEASNFQMDRKTRFIIHGFIDKGDESWVTDMCKKLFEVEEVNCICVDWKKGSQATYTQAANNVRVVGAQVAQMLDILLTEYSYPPSKVHLIGHSLGAHVAGEAGSKTPGLSRITGLDPVEASFESTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQQMGHLDFFPNGGESMPGCKKNALSQIVDLDGIWAGTRDFVACNHLRSYKYYLESILNPDGFAAYPCTSYKSFESDKCFPCPDQ... | 467 | 51,847.1853 | 5.474072 | 0.109208 | 23.328694 | -0.252891 | 0.282655 | 0.30621 | 0.379015 | 29 | 0.062 | 13 | 0.028 | 27 | 0.058 | 28 | 0.06 | 28 | 0.06 | 39 | 0.084 | 10 | 0.021 | 26 | 0.056 | 29 | 0.062 | 39 | 0.084 | 7 | 0.015 | 22 | 0.047 | 25 | 0.054 | 16 | 0.034 | 15 | 0.032 | 30 | 0.064 | 35 | 0.075 | 26 | 0.056 | 8 | 0.017 | 15 | 0.032 | 467 | 51,846.38 | -11.618 | -0.000224 | P54315 | LIPR1_HUMAN | Inactive pancreatic lipase-related protein 1 (PL-RP1) | Homo sapiens (Human) | 467 | 51,848 | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:1379598, ECO:0000269|PubMed:19824014}. | cholesterol homeostasis [GO:0042632]; fatty acid biosynthetic process [GO:0006633]; high-density lipoprotein particle remodeling [GO:0034375]; triglyceride catabolic process [GO:0019433] | calcium ion binding [GO:0005509]; lipoprotein lipase activity [GO:0004465]; phospholipase A1 activity [GO:0008970]; triacylglycerol lipase activity [GO:0004806] | nan | nan | nan | nan | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:1379598, ECO:0000269|PubMed:19824014}. | FUNCTION: May function as inhibitor of dietary triglyceride digestion. Lacks detectable lipase activity towards triglycerides, diglycerides, phosphatidylcholine, galactolipids or cholesterol esters (in vitro) (By similarity). {ECO:0000250, ECO:0000269|PubMed:19824014}. | nan | nan | nan |
P55072 | MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEV... | 806 | 89,320.7757 | 5.138154 | 0.058313 | 39.696042 | -0.347643 | 0.333747 | 0.297767 | 0.322581 | 65 | 0.081 | 12 | 0.015 | 62 | 0.077 | 68 | 0.084 | 31 | 0.038 | 63 | 0.078 | 10 | 0.012 | 59 | 0.073 | 47 | 0.058 | 69 | 0.086 | 20 | 0.025 | 32 | 0.04 | 43 | 0.053 | 26 | 0.032 | 58 | 0.072 | 40 | 0.05 | 32 | 0.04 | 53 | 0.066 | 3 | 0.004 | 13 | 0.016 | 806 | 89,320.05 | -25.441 | -0.000285 | P55072 | TERA_HUMAN | Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) | Homo sapiens (Human) | 806 | 89,322 | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000269|PubMed:15456787}. Endoplasmic reticulum {ECO:0000269|PubMed:15215856}. Nucleus {ECO:0000269|PubMed:23042605, ECO:0000269|PubMed:26842564}. Cytoplasm, Stress granule {ECO:0000269|PubMed:29804830}. Note=Present in the neuronal hyaline inclusion bodies specifically fou... | aggresome assembly [GO:0070842]; ATP metabolic process [GO:0046034]; autophagosome maturation [GO:0097352]; autophagy [GO:0006914]; cellular response to arsenite ion [GO:1903843]; cellular response to heat [GO:0034605]; cellular response to misfolded protein [GO:0071218]; cytoplasm protein quality control [GO:0140455];... | ADP binding [GO:0043531]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; BAT3 complex binding [GO:1904288]; deubiquitinase activator activity [GO:0035800]; identical protein binding [GO:0042802]; K48-linked polyubiquitin modification-dependent protein binding [GO:0036435]; lipid binding [GO:0008289]; M... | 3.6.4.6 | nan | CATALYTIC ACTIVITY: Reaction=ATP + H2O = ADP + phosphate + H(+); Xref=Rhea:RHEA:13065, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:43474, ChEBI:CHEBI:456216; EC=3.6.4.6; Evidence={ECO:0000269|PubMed:26471729}; | nan | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000269|PubMed:15456787}. Endoplasmic reticulum {ECO:0000269|PubMed:15215856}. Nucleus {ECO:0000269|PubMed:23042605, ECO:0000269|PubMed:26842564}. Cytoplasm, Stress granule {ECO:0000269|PubMed:29804830}. Note=Present in the neuronal hyaline inclusion bodies specifically fou... | FUNCTION: Necessary for the fragmentation of Golgi stacks during mitosis and for their reassembly after mitosis. Involved in the formation of the transitional endoplasmic reticulum (tER). The transfer of membranes from the endoplasmic reticulum to the Golgi apparatus occurs via 50-70 nm transition vesicles which derive... | DOMAIN: The PIM (PUB-interaction motif) motif mediates interaction with the PUB domain of RNF31. {ECO:0000269|PubMed:24726327}. | nan | nan |
P55072 | MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEV... | 806 | 89,320.7757 | 5.138154 | 0.058313 | 39.696042 | -0.347643 | 0.333747 | 0.297767 | 0.322581 | 65 | 0.081 | 12 | 0.015 | 62 | 0.077 | 68 | 0.084 | 31 | 0.038 | 63 | 0.078 | 10 | 0.012 | 59 | 0.073 | 47 | 0.058 | 69 | 0.086 | 20 | 0.025 | 32 | 0.04 | 43 | 0.053 | 26 | 0.032 | 58 | 0.072 | 40 | 0.05 | 32 | 0.04 | 53 | 0.066 | 3 | 0.004 | 13 | 0.016 | 806 | 89,320.05 | -25.441 | -0.000285 | Q01853 | TERA_MOUSE | Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP) | Mus musculus (Mouse) | 806 | 89,322 | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000250|UniProtKB:P55072}. Endoplasmic reticulum {ECO:0000250|UniProtKB:P55072}. Nucleus {ECO:0000250|UniProtKB:P55072}. Cytoplasm, Stress granule {ECO:0000250|UniProtKB:P55072}. Nucleus {ECO:0000269|PubMed:33590678}. Note=Recruited to the cytoplasmic surface of the endopla... | aggresome assembly [GO:0070842]; ATP metabolic process [GO:0046034]; autophagosome maturation [GO:0097352]; autophagy [GO:0006914]; cellular response to arsenite ion [GO:1903843]; cellular response to heat [GO:0034605]; cellular response to misfolded protein [GO:0071218]; cytoplasm protein quality control [GO:0140455];... | ADP binding [GO:0043531]; ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; BAT3 complex binding [GO:1904288]; deubiquitinase activator activity [GO:0035800]; identical protein binding [GO:0042802]; K48-linked polyubiquitin modification-dependent protein binding [GO:0036435]; lipid binding [GO:0008289]; M... | 3.6.4.6 | nan | CATALYTIC ACTIVITY: Reaction=ATP + H2O = ADP + phosphate + H(+); Xref=Rhea:RHEA:13065, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:43474, ChEBI:CHEBI:456216; EC=3.6.4.6; Evidence={ECO:0000250|UniProtKB:P55072}; | nan | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000250|UniProtKB:P55072}. Endoplasmic reticulum {ECO:0000250|UniProtKB:P55072}. Nucleus {ECO:0000250|UniProtKB:P55072}. Cytoplasm, Stress granule {ECO:0000250|UniProtKB:P55072}. Nucleus {ECO:0000269|PubMed:33590678}. Note=Recruited to the cytoplasmic surface of the endopla... | FUNCTION: Necessary for the fragmentation of Golgi stacks during mitosis and for their reassembly after mitosis. Involved in the formation of the transitional endoplasmic reticulum (tER). The transfer of membranes from the endoplasmic reticulum to the Golgi apparatus occurs via 50-70 nm transition vesicles which derive... | DOMAIN: The N-terminal domain shows evolutionary conservation with that of PEX1, and is able to bind phospholipids with a preference for phosphatidylinositol mono- and bisphosphates.; DOMAIN: The PIM (PUB-interaction motif) motif mediates interaction with the PUB domain of RNF31. {ECO:0000250|UniProtKB:P55072}. | nan | nan |
P54707 | MHQKTPEIYSVELSGTKDIVKTDKGDGKEKYRGLKNNCLELKKKNHKEEFQKELHLDDHKLSNRELEEKYGTDIIMGLSSTRAAELLARDGPNSLTPPKQTPEIVKFLKQMVGGFSILLWVGAFLCWIAYGIQYSSDKSASLNNVYLGCVLGLVVILTGIFAYYQEAKSTNIMSSFNKMIPQQALVIRDSEKKTIPSEQLVVGDIVEVKGGDQIPADIRVLSSQGCRVDNSSLTGESEPQPRSSEFTHENPLETKNICFYSTTCLEGTVTGMVINTGDRTIIGHIASLASGVGNEKTPIAIEIEHFVHIVAGVAVSIGIL... | 1,039 | 115,509.1536 | 6.123231 | 0.081809 | 31.661607 | 0.015592 | 0.316651 | 0.264678 | 0.405197 | 73 | 0.07 | 15 | 0.014 | 54 | 0.052 | 64 | 0.062 | 41 | 0.039 | 69 | 0.066 | 20 | 0.019 | 97 | 0.093 | 68 | 0.065 | 98 | 0.094 | 26 | 0.025 | 45 | 0.043 | 37 | 0.036 | 37 | 0.036 | 40 | 0.038 | 70 | 0.067 | 64 | 0.062 | 77 | 0.074 | 12 | 0.012 | 32 | 0.031 | 1,039 | 115,508.54 | -10.537 | -0.000091 | P54707 | AT12A_HUMAN | Potassium-transporting ATPase alpha chain 2 (HK alpha 2) (Non-gastric H(+)/K(+) ATPase subunit alpha) (EC 7.2.2.19) (Non-gastric Na(+)/K(+) ATPase subunit alpha) (EC 7.2.2.13) (Proton pump) (Sodium pump) | Homo sapiens (Human) | 1,039 | 115,511 | SUBCELLULAR LOCATION: Apical cell membrane {ECO:0000269|PubMed:16914892}; Multi-pass membrane protein {ECO:0000255}. | intracellular potassium ion homeostasis [GO:0030007]; intracellular sodium ion homeostasis [GO:0006883]; potassium ion import across plasma membrane [GO:1990573]; proton transmembrane transport [GO:1902600]; regulation of pH [GO:0006885]; sodium ion export across plasma membrane [GO:0036376] | ATP binding [GO:0005524]; ATP hydrolysis activity [GO:0016887]; metal ion binding [GO:0046872]; P-type potassium:proton transporter activity [GO:0008900]; P-type sodium:potassium-exchanging transporter activity [GO:0005391] | 7.2.2.13; 7.2.2.19 | nan | CATALYTIC ACTIVITY: Reaction=K(+)(out) + ATP + H2O + H(+)(in) = K(+)(in) + ADP + phosphate + 2 H(+)(out); Xref=Rhea:RHEA:22044, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:29103, ChEBI:CHEBI:30616, ChEBI:CHEBI:43474, ChEBI:CHEBI:456216; EC=7.2.2.19; Evidence={ECO:0000269|PubMed:11341842, ECO:0000269|PubMed:748547... | nan | SUBCELLULAR LOCATION: Apical cell membrane {ECO:0000269|PubMed:16914892}; Multi-pass membrane protein {ECO:0000255}. | FUNCTION: The catalytic subunit of a H(+)/K(+) ATPase and/or Na(+)/K(+) ATPase pump which transports K(+) ions in exchange for Na(+) and/or H(+) ions across the apical membrane of epithelial cells. Uses ATP as an energy source to pump K(+) ions into the cell while transporting Na(+) and/or H(+) ions to the extracellula... | nan | INDUCTION: Up-regulated by inflammatory cytokine IL13. {ECO:0000269|PubMed:29391451}. | nan |
P54296 | MSLVTVPFYQKRHRHFDQSYRNIQTRYLLDEYASKKRASTQASSQKSLSQRSSSQRASSQTSLGGTICRVCAKRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHLEEDVHLARSQARDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEPGKYRIESNYGVHTLEINRADFDDTATYSAVATNAHGQVSTNAAVVVRRFRGDEEPFRSVGLPIGLPLSSMIPYTHFDVQFLEKFGVTFRREGETVTLKCTMLVTPDLKRVQPRAEWYRDD... | 1,465 | 164,867.3391 | 5.817948 | 0.091468 | 39.09086 | -0.448259 | 0.297611 | 0.286007 | 0.348805 | 95 | 0.065 | 27 | 0.018 | 91 | 0.062 | 113 | 0.077 | 58 | 0.04 | 93 | 0.063 | 37 | 0.025 | 66 | 0.045 | 94 | 0.064 | 106 | 0.072 | 28 | 0.019 | 44 | 0.03 | 71 | 0.048 | 59 | 0.04 | 82 | 0.056 | 120 | 0.082 | 83 | 0.057 | 122 | 0.083 | 23 | 0.016 | 53 | 0.036 | 1,465 | 164,866.86 | -29.695 | -0.00018 | P54296 | MYOM2_HUMAN | Myomesin-2 (165 kDa connectin-associated protein) (165 kDa titin-associated protein) (M-protein) (Myomesin family member 2) | Homo sapiens (Human) | 1,465 | 164,869 | SUBCELLULAR LOCATION: Cytoplasm, myofibril, sarcomere, M line {ECO:0000250}. | extraocular skeletal muscle development [GO:0002074]; muscle contraction [GO:0006936]; sarcomere organization [GO:0045214] | kinase binding [GO:0019900]; structural constituent of muscle [GO:0008307] | nan | nan | nan | nan | SUBCELLULAR LOCATION: Cytoplasm, myofibril, sarcomere, M line {ECO:0000250}. | FUNCTION: Major component of the vertebrate myofibrillar M band. Binds myosin, titin, and light meromyosin. This binding is dose dependent. | nan | nan | nan |
P55196 | MSAGGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPPKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILD... | 1,824 | 206,801.821 | 6.061617 | 0.060855 | 62.199731 | -0.863816 | 0.332785 | 0.30318 | 0.281798 | 126 | 0.069 | 18 | 0.01 | 119 | 0.065 | 162 | 0.089 | 47 | 0.026 | 91 | 0.05 | 40 | 0.022 | 69 | 0.038 | 117 | 0.064 | 158 | 0.087 | 44 | 0.024 | 62 | 0.034 | 135 | 0.074 | 109 | 0.06 | 141 | 0.077 | 146 | 0.08 | 95 | 0.052 | 81 | 0.044 | 15 | 0.008 | 49 | 0.027 | 1,824 | 206,801.47 | -23.156 | -0.000112 | P55196 | AFAD_HUMAN | Afadin (ALL1-fused gene from chromosome 6 protein) (Protein AF-6) (Afadin adherens junction formation factor) | Homo sapiens (Human) | 1,824 | 206,804 | SUBCELLULAR LOCATION: Cell junction, adherens junction {ECO:0000269|PubMed:30463011}. Note=Not found at cell-matrix AJs. {ECO:0000250|UniProtKB:O35889}. | bicellular tight junction assembly [GO:0070830]; cell adhesion [GO:0007155]; cell-cell adhesion mediated by cadherin [GO:0044331]; cell-cell signaling [GO:0007267]; establishment of endothelial intestinal barrier [GO:0090557]; establishment of protein localization to plasma membrane [GO:0061951]; negative regulation of... | actin filament binding [GO:0051015]; cadherin binding [GO:0045296]; cell adhesion molecule binding [GO:0050839]; small GTPase binding [GO:0031267] | nan | nan | nan | nan | SUBCELLULAR LOCATION: Cell junction, adherens junction {ECO:0000269|PubMed:30463011}. Note=Not found at cell-matrix AJs. {ECO:0000250|UniProtKB:O35889}. | FUNCTION: Belongs to an adhesion system, probably together with the E-cadherin-catenin system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs) (By similarity). Nectin- and actin-filament-binding protein that connects nectin to the actin cytoskeleton ... | DOMAIN: The PDZ/DHR domain interacts with the C-terminus of nectin and the Pro-rich C-terminal domain interacts with F-actin. | nan | nan |
P55287 | MKENYCLQAALVCLGMLCHSHAFAPERRGHLRPSFHGHHEKGKEGQVLQRSKRGWVWNQFFVIEEYTGPDPVLVGRLHSDIDSGDGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDREERAQYTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPEFLHETYHANVPERSNVGTSVIQVTASDADDPTYGNSAKLVYSILEGQPYFSVEAQTGIIRTALPNMDREAKEEYHVVIQAKDMGGHMGGLSGTTKVTITLTDVNDNPPKFPQSVYQMSVSEAAVPGEEVGRVKAKDPDIGENGLVTYNIVDGDGMESFEITT... | 796 | 87,964.2473 | 4.746874 | 0.079146 | 36.796608 | -0.419598 | 0.268844 | 0.331658 | 0.350503 | 58 | 0.073 | 8 | 0.01 | 69 | 0.087 | 55 | 0.069 | 31 | 0.039 | 57 | 0.072 | 19 | 0.024 | 57 | 0.072 | 39 | 0.049 | 51 | 0.064 | 11 | 0.014 | 41 | 0.052 | 52 | 0.065 | 26 | 0.033 | 37 | 0.046 | 45 | 0.057 | 49 | 0.062 | 59 | 0.074 | 4 | 0.005 | 28 | 0.035 | 796 | 87,963.56 | -47.48 | -0.00054 | P55287 | CAD11_HUMAN | Cadherin-11 (OSF-4) (Osteoblast cadherin) (OB-cadherin) | Homo sapiens (Human) | 796 | 87,965 | SUBCELLULAR LOCATION: Cell membrane; Single-pass type I membrane protein. | adherens junction organization [GO:0034332]; aortic valve formation [GO:0003189]; calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules [GO:0016339]; cell adhesion [GO:0007155]; cell migration [GO:0016477]; cell morphogenesis [GO:0000902]; cell-cell adhesion mediated by cadherin [GO:0044331];... | beta-catenin binding [GO:0008013]; cadherin binding [GO:0045296]; calcium ion binding [GO:0005509] | nan | nan | nan | nan | SUBCELLULAR LOCATION: Cell membrane; Single-pass type I membrane protein. | FUNCTION: Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. Required for proper focal adhesion assembly (PubMed:33811546). Involved in the regulation o... | DOMAIN: Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain. {ECO:0000250}. | nan | nan |
P54198 | MKLLKPTWVNHNGKPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMSPVLQEDDEKDENIPKMLCQMDNHLACVNCVRWSNSGMYLASGGDDKLIMVWKRATYIGPSTVFGSSGKLANVEQWRCVSILRNHSGDVMDVAWSPHDAWLASCSVDNTVVIWNAVKFPEILATLRGHSGLVKGLTWDPVGKYIASQADDRSLKVWRTLDWQLETSITKPFDECGGTTHVLRLSWSPDGHYLVSAHAMNNSGPTAQIIEREGWKTNMDFVGHRKAVTVVKFNPKIFKKKQKNGSSAKPSCPYCCCAVGSKDRSLSVWLTCLKRPL... | 1,017 | 111,833.8999 | 8.397023 | 0.05998 | 47.795477 | -0.228712 | 0.320551 | 0.302852 | 0.344149 | 73 | 0.072 | 26 | 0.026 | 52 | 0.051 | 55 | 0.054 | 25 | 0.025 | 58 | 0.057 | 21 | 0.021 | 39 | 0.038 | 63 | 0.062 | 109 | 0.107 | 26 | 0.026 | 34 | 0.033 | 53 | 0.052 | 43 | 0.042 | 52 | 0.051 | 111 | 0.109 | 62 | 0.061 | 79 | 0.078 | 20 | 0.02 | 16 | 0.016 | 1,017 | 111,833.28 | 5.84 | 0.000052 | P54198 | HIRA_HUMAN | Protein HIRA (TUP1-like enhancer of split protein 1) | Homo sapiens (Human) | 1,017 | 111,835 | SUBCELLULAR LOCATION: Nucleus. Nucleus, PML body. Note=Primarily, though not exclusively, localized to the nucleus. Localizes to PML bodies immediately prior to onset of senescence. | anatomical structure morphogenesis [GO:0009653]; chromatin remodeling [GO:0006338]; DNA-templated transcription [GO:0006351]; gastrulation [GO:0007369]; muscle cell differentiation [GO:0042692]; nucleosome assembly [GO:0006334]; osteoblast differentiation [GO:0001649]; regulation of transcription by RNA polymerase II [... | histone binding [GO:0042393]; RNA polymerase II-specific DNA-binding transcription factor binding [GO:0061629]; transcription corepressor activity [GO:0003714] | nan | nan | nan | nan | SUBCELLULAR LOCATION: Nucleus. Nucleus, PML body. Note=Primarily, though not exclusively, localized to the nucleus. Localizes to PML bodies immediately prior to onset of senescence. | FUNCTION: Cooperates with ASF1A to promote replication-independent chromatin assembly. Required for the periodic repression of histone gene transcription during the cell cycle. Required for the formation of senescence-associated heterochromatin foci (SAHF) and efficient senescence-associated cell cycle exit. {ECO:00002... | nan | nan | nan |
P55809 | MAALKLLSSGLRLCASARGSGATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGATVLVGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENAEFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREVREFNGQHFILEEAITGDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIERLSIRKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYAN... | 520 | 56,156.9802 | 7.133373 | 0.067308 | 25.424462 | -0.1075 | 0.35 | 0.288462 | 0.344231 | 48 | 0.092 | 8 | 0.015 | 25 | 0.048 | 36 | 0.069 | 19 | 0.037 | 54 | 0.104 | 10 | 0.019 | 33 | 0.063 | 38 | 0.073 | 45 | 0.087 | 15 | 0.029 | 19 | 0.037 | 21 | 0.04 | 13 | 0.025 | 23 | 0.044 | 31 | 0.06 | 27 | 0.052 | 39 | 0.075 | 4 | 0.008 | 12 | 0.023 | 520 | 56,156.18 | 0.157 | 0.000003 | P55809 | SCOT1_HUMAN | Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial (SCOT) (EC 2.8.3.5) (3-oxoacid CoA-transferase 1) (Somatic-type succinyl-CoA:3-oxoacid CoA-transferase) (SCOT-s) (Succinyl-CoA:3-oxoacid CoA transferase) | Homo sapiens (Human) | 520 | 56,158 | SUBCELLULAR LOCATION: Mitochondrion {ECO:0000250|UniProtKB:B2GV06}. | adipose tissue development [GO:0060612]; heart development [GO:0007507]; ketone body catabolic process [GO:0046952]; ketone body metabolic process [GO:1902224]; ketone catabolic process [GO:0042182]; positive regulation of insulin secretion involved in cellular response to glucose stimulus [GO:0035774]; response to act... | identical protein binding [GO:0042802]; succinyl-CoA:3-oxo-acid CoA-transferase activity [GO:0008260] | 2.8.3.5 | nan | CATALYTIC ACTIVITY: Reaction=a 3-oxo acid + succinyl-CoA = a 3-oxoacyl-CoA + succinate; Xref=Rhea:RHEA:24564, ChEBI:CHEBI:30031, ChEBI:CHEBI:35973, ChEBI:CHEBI:57292, ChEBI:CHEBI:90726; EC=2.8.3.5; Evidence={ECO:0000269|PubMed:10964512}; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:24565; Evidence={ECO:0000305|... | PATHWAY: Ketone metabolism; succinyl-CoA degradation; acetoacetyl-CoA from succinyl-CoA: step 1/1. {ECO:0000305|PubMed:10964512}. | SUBCELLULAR LOCATION: Mitochondrion {ECO:0000250|UniProtKB:B2GV06}. | FUNCTION: Key enzyme for ketone body catabolism. Catalyzes the first, rate-limiting step of ketone body utilization in extrahepatic tissues, by transferring coenzyme A (CoA) from a donor thiolester species (succinyl-CoA) to an acceptor carboxylate (acetoacetate), and produces acetoacetyl-CoA. Acetoacetyl-CoA is further... | nan | nan | nan |
P53804 | MDNFAEGDFTVADYALLEDCPHVDDCVFAAEFMSNDYVRVTQLYCDGVGVQYKDYIQSERNLEFDICSIWCSKPISVLQDYCDAIKINIFWPLLFQHQNSSVISRLHPCVDANNSRASEINLKKLQHLELMEDIVDLAKKVANDSFLIGGLLRIGCKIENKILAMEEALNWIKYAGDVTILTKLGSIDNCWPMLSIFFTEYKYHITKIVMEDCNLLEELKTQSCMDCIEEGELMKMKGNEEFSKERFDIAIIYYTRAIEYRPENYLLYGNRALCFLRTGQFRNALGDGKRATILKNTWPKGHYRYCDALSMLGEYDWALQ... | 2,025 | 229,866.3225 | 7.531075 | 0.078519 | 49.13003 | -0.589531 | 0.348148 | 0.285432 | 0.315062 | 120 | 0.059 | 55 | 0.027 | 105 | 0.052 | 176 | 0.087 | 76 | 0.038 | 91 | 0.045 | 47 | 0.023 | 118 | 0.058 | 199 | 0.098 | 180 | 0.089 | 30 | 0.015 | 100 | 0.049 | 109 | 0.054 | 98 | 0.048 | 84 | 0.041 | 173 | 0.085 | 74 | 0.037 | 107 | 0.053 | 21 | 0.01 | 62 | 0.031 | 2,025 | 229,866.12 | -3.624 | -0.000016 | P53804 | TTC3_HUMAN | E3 ubiquitin-protein ligase TTC3 (EC 2.3.2.27) (Protein DCRR1) (RING finger protein 105) (RING-type E3 ubiquitin transferase TTC3) (TPR repeat protein D) (Tetratricopeptide repeat protein 3) (TPR repeat protein 3) | Homo sapiens (Human) | 2,025 | 229,869 | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:20059950, ECO:0000269|PubMed:30203323}. Cytoplasm {ECO:0000269|PubMed:30203323}. Golgi apparatus {ECO:0000250|UniProtKB:D3ZSP7}. Note=Nuclear localization may be dependent on the proteolytic cleavage of full length protein in the cytoplasm (PubMed:30203323). This cleava... | protein K48-linked ubiquitination [GO:0070936]; ubiquitin-dependent protein catabolic process [GO:0006511] | ubiquitin-protein transferase activity [GO:0004842]; zinc ion binding [GO:0008270] | 2.3.2.27 | nan | CATALYTIC ACTIVITY: Reaction=S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.; EC=2.3.2.27; Evidence={ECO:0000269|PubMed:20059950, ECO:0000269|PubMed:30696809}; | PATHWAY: Protein modification; protein ubiquitination. {ECO:0000269|PubMed:20059950, ECO:0000269|PubMed:30696809}. | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:20059950, ECO:0000269|PubMed:30203323}. Cytoplasm {ECO:0000269|PubMed:30203323}. Golgi apparatus {ECO:0000250|UniProtKB:D3ZSP7}. Note=Nuclear localization may be dependent on the proteolytic cleavage of full length protein in the cytoplasm (PubMed:30203323). This cleava... | FUNCTION: E3 ubiquitin-protein ligase which catalyzes the formation of 'Lys-48'-polyubiquitin chains (PubMed:20059950, PubMed:30696809). Mediates the ubiquitination and subsequent degradation of phosphorylated Akt (AKT1, AKT2 and AKT3) in the nucleus (PubMed:20059950). Acts as a terminal regulator of Akt signaling afte... | nan | INDUCTION: Up-regulated by TGFB1 signaling. {ECO:0000269|PubMed:30696809}. | nan |
P55327 | MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKFGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL | 224 | 24,326.7149 | 4.789788 | 0.058036 | 63.524107 | -0.652679 | 0.40625 | 0.299107 | 0.308036 | 20 | 0.089 | 1 | 0.004 | 10 | 0.045 | 27 | 0.121 | 7 | 0.031 | 14 | 0.062 | 1 | 0.004 | 6 | 0.027 | 21 | 0.094 | 21 | 0.094 | 2 | 0.009 | 8 | 0.036 | 11 | 0.049 | 11 | 0.049 | 5 | 0.022 | 24 | 0.107 | 17 | 0.076 | 12 | 0.054 | 1 | 0.004 | 5 | 0.022 | 224 | 24,325.82 | -10.127 | -0.000416 | P55327 | TPD52_HUMAN | Tumor protein D52 (Protein N8) | Homo sapiens (Human) | 224 | 24,327 | nan | anatomical structure morphogenesis [GO:0009653]; B cell differentiation [GO:0030183]; positive regulation of cell population proliferation [GO:0008284]; secretion [GO:0046903] | calcium ion binding [GO:0005509]; protein homodimerization activity [GO:0042803] | nan | nan | nan | nan | nan | nan | nan | nan | nan |
P53618 | MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLMTIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDFLVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDILQLVIVELIYKVCHANPSERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLIVLDRLIELKEHPAHERVLQD... | 953 | 107,141.0207 | 5.721038 | 0.057712 | 37.808814 | -0.091186 | 0.378804 | 0.242392 | 0.377754 | 75 | 0.079 | 20 | 0.021 | 58 | 0.061 | 72 | 0.076 | 28 | 0.029 | 29 | 0.03 | 22 | 0.023 | 67 | 0.07 | 69 | 0.072 | 117 | 0.123 | 28 | 0.029 | 44 | 0.046 | 39 | 0.041 | 34 | 0.036 | 42 | 0.044 | 61 | 0.064 | 50 | 0.052 | 71 | 0.075 | 4 | 0.004 | 23 | 0.024 | 953 | 107,140.36 | -20.201 | -0.000189 | P53618 | COPB_HUMAN | Coatomer subunit beta (Beta-coat protein) (Beta-COP) | Homo sapiens (Human) | 953 | 107,142 | SUBCELLULAR LOCATION: Cytoplasm. Golgi apparatus membrane {ECO:0000269|PubMed:11056392, ECO:0000269|PubMed:17451557, ECO:0000269|PubMed:7573041}; Peripheral membrane protein {ECO:0000269|PubMed:17451557, ECO:0000269|PubMed:18385291, ECO:0000269|PubMed:20056612}; Cytoplasmic side {ECO:0000305}. Cytoplasmic vesicle, COPI... | endoplasmic reticulum to Golgi vesicle-mediated transport [GO:0006888]; intra-Golgi vesicle-mediated transport [GO:0006891]; intracellular protein transport [GO:0006886] | structural molecule activity [GO:0005198] | nan | nan | nan | nan | SUBCELLULAR LOCATION: Cytoplasm. Golgi apparatus membrane {ECO:0000269|PubMed:11056392, ECO:0000269|PubMed:17451557, ECO:0000269|PubMed:7573041}; Peripheral membrane protein {ECO:0000269|PubMed:17451557, ECO:0000269|PubMed:18385291, ECO:0000269|PubMed:20056612}; Cytoplasmic side {ECO:0000305}. Cytoplasmic vesicle, COPI... | FUNCTION: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membra... | nan | nan | nan |
P55273 | MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL | 166 | 17,699.9672 | 5.691141 | 0.024096 | 28.65241 | -0.000602 | 0.373494 | 0.26506 | 0.343373 | 21 | 0.127 | 0 | 0 | 12 | 0.072 | 9 | 0.054 | 4 | 0.024 | 15 | 0.09 | 8 | 0.048 | 3 | 0.018 | 3 | 0.018 | 25 | 0.151 | 4 | 0.024 | 3 | 0.018 | 7 | 0.042 | 8 | 0.048 | 12 | 0.072 | 7 | 0.042 | 9 | 0.054 | 16 | 0.096 | 0 | 0 | 0 | 0 | 166 | 17,699.04 | -4.67 | -0.000264 | P55273 | CDN2D_HUMAN | Cyclin-dependent kinase 4 inhibitor D (p19-INK4d) | Homo sapiens (Human) | 166 | 17,700 | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:9482106}. Cytoplasm {ECO:0000269|PubMed:9482106}. | autophagic cell death [GO:0048102]; DNA synthesis involved in DNA repair [GO:0000731]; negative regulation of cell growth [GO:0030308]; negative regulation of cell population proliferation [GO:0008285]; negative regulation of G1/S transition of mitotic cell cycle [GO:2000134]; negative regulation of intrinsic apoptotic... | cyclin-dependent protein serine/threonine kinase inhibitor activity [GO:0004861]; protein kinase binding [GO:0019901] | nan | nan | nan | nan | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:9482106}. Cytoplasm {ECO:0000269|PubMed:9482106}. | FUNCTION: Interacts strongly with CDK4 and CDK6 and inhibits them. {ECO:0000269|PubMed:7739548, ECO:0000269|PubMed:8741839}. | nan | nan | nan |
P53567 | MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ | 150 | 16,408.1944 | 9.772972 | 0.013333 | 45.688667 | -0.952 | 0.346667 | 0.326667 | 0.24 | 12 | 0.08 | 0 | 0 | 7 | 0.047 | 9 | 0.06 | 1 | 0.007 | 10 | 0.067 | 4 | 0.027 | 5 | 0.033 | 15 | 0.1 | 13 | 0.087 | 3 | 0.02 | 11 | 0.073 | 6 | 0.04 | 14 | 0.093 | 8 | 0.053 | 15 | 0.1 | 7 | 0.047 | 9 | 0.06 | 0 | 0 | 1 | 0.007 | 150 | 16,407.27 | 8.153 | 0.000497 | P53567 | CEBPG_HUMAN | CCAAT/enhancer-binding protein gamma (C/EBP gamma) | Homo sapiens (Human) | 150 | 16,408 | SUBCELLULAR LOCATION: Nucleus {ECO:0000250|UniProtKB:P53568}. | B cell differentiation [GO:0030183]; DNA-templated transcription [GO:0006351]; enucleate erythrocyte differentiation [GO:0043353]; immune response [GO:0006955]; integrated stress response signaling [GO:0140467]; liver development [GO:0001889]; mRNA metabolic process [GO:0016071]; natural killer cell mediated cytotoxici... | DNA binding [GO:0003677]; DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity, RNA polymerase II-specific [GO:0000981]; DNA-binding transcription factor binding [GO:0140297]; identical protein binding [GO:0042802]; RNA polymerase II cis-regula... | nan | nan | nan | nan | SUBCELLULAR LOCATION: Nucleus {ECO:0000250|UniProtKB:P53568}. | FUNCTION: Transcription factor that binds to the promoter and the enhancer regions of target genes. Binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene (PubMed:7665092). Binds to the promoter and the enhancer of the immunoglobulin heavy chain. Binds to GPE1, a cis-acting element in the ... | nan | nan | nan |
P52961 | MQMPAMMSLLLVSVGLMEALQAQSHPITRRDLFSQEIQLDMALASFDDQYAGCAAAMTAALPDLNHTEFQANQVYADSWTLASSQWQERQARWPEWSLSPTRPSPPPLGFRDEHGVALLAYTANSPLHKEFNAAVREAGRSRAHYLHHFSFKTLHFLLTEALQLLGSGQRPPRCHQVFRGVHGLRFRPAGPRATVRLGGFASASLKHVAAQQFGEDTFFGIWTCLGAPIKGYSFFPGEEEVLIPPFETFQVINASRLAQGPARIYLRALGKHSTYNCEYIKDKKCKSGPCHLDNSAMGQSPLSAVWSLLLLLWFLVVRAF... | 327 | 36,334.243 | 8.526089 | 0.107034 | 46.081651 | -0.113456 | 0.336391 | 0.272171 | 0.33945 | 37 | 0.113 | 6 | 0.018 | 11 | 0.034 | 15 | 0.046 | 20 | 0.061 | 23 | 0.07 | 13 | 0.04 | 8 | 0.024 | 9 | 0.028 | 41 | 0.125 | 8 | 0.024 | 7 | 0.021 | 23 | 0.07 | 19 | 0.058 | 20 | 0.061 | 25 | 0.076 | 13 | 0.04 | 14 | 0.043 | 7 | 0.021 | 8 | 0.024 | 327 | 36,333.38 | 3.599 | 0.000099 | P52961 | NAR1_HUMAN | GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1 (EC 2.4.2.31) (ADP-ribosyltransferase C2 and C3 toxin-like 1) (ARTC1) (Mono(ADP-ribosyl)transferase 1) (CD antigen CD296) | Homo sapiens (Human) | 327 | 36,335 | SUBCELLULAR LOCATION: Sarcoplasmic reticulum membrane; Lipid-anchor, GPI-anchor. | nan | NAD+ poly-ADP-ribosyltransferase activity [GO:0003950]; NAD+-protein-arginine ADP-ribosyltransferase activity [GO:0106274]; nucleotidyltransferase activity [GO:0016779] | 2.4.2.31 | nan | CATALYTIC ACTIVITY: Reaction=L-arginyl-[protein] + NAD(+) = N(omega)-(ADP-D-ribosyl)-L-arginyl-[protein] + nicotinamide + H(+); Xref=Rhea:RHEA:19149, Rhea:RHEA-COMP:10532, Rhea:RHEA-COMP:15087, ChEBI:CHEBI:15378, ChEBI:CHEBI:17154, ChEBI:CHEBI:29965, ChEBI:CHEBI:57540, ChEBI:CHEBI:142554; EC=2.4.2.31; | nan | SUBCELLULAR LOCATION: Sarcoplasmic reticulum membrane; Lipid-anchor, GPI-anchor. | FUNCTION: Has ADP-ribosyltransferase activity toward GLP1R. {ECO:0000269|PubMed:21901419}. | nan | nan | nan |
P52952 | MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHG... | 324 | 34,917.2948 | 9.461267 | 0.083333 | 66.035833 | -0.464815 | 0.351852 | 0.317901 | 0.262346 | 52 | 0.16 | 7 | 0.022 | 10 | 0.031 | 17 | 0.052 | 10 | 0.031 | 20 | 0.062 | 1 | 0.003 | 5 | 0.015 | 15 | 0.046 | 28 | 0.086 | 2 | 0.006 | 11 | 0.034 | 41 | 0.127 | 17 | 0.052 | 25 | 0.077 | 21 | 0.065 | 10 | 0.031 | 15 | 0.046 | 2 | 0.006 | 15 | 0.046 | 324 | 34,916.43 | 12.927 | 0.00037 | P52952 | NKX25_HUMAN | Homeobox protein Nkx-2.5 (Cardiac-specific homeobox) (Homeobox protein CSX) (Homeobox protein NK-2 homolog E) | Homo sapiens (Human) | 324 | 34,918 | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:29899023}. | adult heart development [GO:0007512]; aortic valve morphogenesis [GO:0003180]; apoptotic process involved in heart morphogenesis [GO:0003278]; atrial cardiac muscle cell development [GO:0055014]; atrial cardiac muscle tissue development [GO:0003228]; atrial septum morphogenesis [GO:0060413]; atrioventricular node cell ... | chromatin binding [GO:0003682]; DNA binding [GO:0003677]; DNA-binding transcription activator activity [GO:0001216]; DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription factor activity [GO:0003700]; DNA-binding transcription factor activity, RNA polymerase II... | nan | nan | nan | nan | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:29899023}. | FUNCTION: Transcription factor required for the development of the heart and the spleen (PubMed:22560297). During heart development, acts as a transcriptional activator of NPPA/ANF in cooperation with GATA4 (By similarity). May cooperate with TBX2 to negatively modulate expression of NPPA/ANF in the atrioventricular ca... | DOMAIN: The homeobox domain binds to double-stranded DNA (PubMed:22849347). {ECO:0000269|PubMed:22849347}. | nan | nan |
P52849 | MLQLWKVVRPARQLELHRLILLLIAFSLGSMGFLAYYVSTSPKAKEPLPLPLGDCSSGGAAGPGPARPPVPPRPPRPPETARTEPVVLVFVESAYSQLGQEIVAILESSRFRYSTELAPGRGDMPTLTDNTHGRYVLVIYENLLKYVNLDAWSRELLDRYCVEYGVGIIGFFRAHEHSLLSAQLKGFPLFLHSNLGLRDYQVNPSAPLLHLTRPSRLEPGPLPGDDWTIFQSNHSTYEPVLLASLRPAEPAVPGPVLRRARLPTVVQDLGLHDGIQRVLFGHGLSFWLHKLIFVDAVAYLTGKRLCLDLDRYILVDIDDI... | 883 | 100,873.3654 | 8.812651 | 0.11778 | 46.791993 | -0.261042 | 0.281993 | 0.289921 | 0.400906 | 46 | 0.052 | 10 | 0.011 | 41 | 0.046 | 43 | 0.049 | 50 | 0.057 | 60 | 0.068 | 33 | 0.037 | 33 | 0.037 | 30 | 0.034 | 117 | 0.133 | 13 | 0.015 | 27 | 0.031 | 68 | 0.077 | 35 | 0.04 | 63 | 0.071 | 60 | 0.068 | 52 | 0.059 | 48 | 0.054 | 17 | 0.019 | 37 | 0.042 | 883 | 100,872.7 | 9.772 | 0.000097 | P52849 | NDST2_HUMAN | Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2 (EC 2.8.2.8) (Glucosaminyl N-deacetylase/N-sulfotransferase 2) (NDST-2) (N-heparan sulfate sulfotransferase 2) (N-HSST 2) [Includes: Heparan sulfate N-deacetylase 2 (EC 3.-.-.-); Heparan sulfate N-sulfotransferase 2 (EC 2.8.2.-)] | Homo sapiens (Human) | 883 | 100,875 | SUBCELLULAR LOCATION: Golgi apparatus membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. | heparan sulfate proteoglycan biosynthetic process [GO:0015012]; heparin proteoglycan biosynthetic process [GO:0030210]; mast cell mediated immunity [GO:0002448]; regulation of angiotensin levels in blood [GO:0002002] | deacetylase activity [GO:0019213]; heparan sulfate N-deacetylase activity [GO:0102140]; heparan sulfate N-sulfotransferase activity [GO:0015016]; N-acetylglucosamine deacetylase activity [GO:0050119] | 2.8.2.-; 2.8.2.8; 3.-.-.- | nan | CATALYTIC ACTIVITY: Reaction=alpha-D-glucosaminyl-[heparan sulfate](n) + 3'-phosphoadenylyl sulfate = N-sulfo-alpha-D-glucosaminyl-[heparan sulfate](n) + adenosine 3',5'-bisphosphate + 2 H(+); Xref=Rhea:RHEA:21980, Rhea:RHEA-COMP:9830, Rhea:RHEA-COMP:14602, ChEBI:CHEBI:15378, ChEBI:CHEBI:58339, ChEBI:CHEBI:58343, ChEBI... | PATHWAY: Glycan metabolism; heparan sulfate biosynthesis.; PATHWAY: Glycan metabolism; heparin biosynthesis. | SUBCELLULAR LOCATION: Golgi apparatus membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. | FUNCTION: Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA disaccharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in hepari... | nan | nan | nan |
P54098 | MSRLLWRKVAGATVGPGPVPAPGRWVSSSVPASDPSDGQRRRQQQQQQQQQQQQQPQQPQVLSSEGGQLRHNPLDIQMLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQKHGLWGQPAVPLPDVELRLPPLYGDNLDQHFRLLAQKQSLPYLEAANLLLQAQLPPKPPAWAWAEGWTRYGPEGEAVPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSQRLVEERYSWTSQLSPADLIPLEVPTGASSPTQRDWQEQLVVGHNVSFDRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQRSLWIAAKQGKH... | 1,239 | 139,560.415 | 6.46057 | 0.082324 | 51.956578 | -0.490315 | 0.334948 | 0.274415 | 0.317998 | 103 | 0.083 | 20 | 0.016 | 57 | 0.046 | 91 | 0.073 | 32 | 0.026 | 92 | 0.074 | 29 | 0.023 | 39 | 0.031 | 58 | 0.047 | 129 | 0.104 | 34 | 0.027 | 27 | 0.022 | 89 | 0.072 | 88 | 0.071 | 82 | 0.066 | 75 | 0.061 | 53 | 0.043 | 71 | 0.057 | 37 | 0.03 | 33 | 0.027 | 1,239 | 139,559.86 | -8.912 | -0.000064 | P54098 | DPOG1_HUMAN | DNA polymerase subunit gamma-1 (EC 2.7.7.7) (3'-5' exodeoxyribonuclease) (EC 3.1.11.-) (5'-deoxyribose-phosphate lyase) (EC 4.2.99.-) (Mitochondrial DNA polymerase catalytic subunit) (PolG-alpha) | Homo sapiens (Human) | 1,239 | 139,562 | SUBCELLULAR LOCATION: Mitochondrion {ECO:0000269|PubMed:10827171, ECO:0000269|PubMed:18063578}. Mitochondrion matrix, mitochondrion nucleoid {ECO:0000269|PubMed:18063578}. | base-excision repair [GO:0006284]; base-excision repair, gap-filling [GO:0006287]; DNA metabolic process [GO:0006259]; DNA replication proofreading [GO:0045004]; DNA-templated DNA replication [GO:0006261]; mitochondrial DNA replication [GO:0006264] | 3'-5' exonuclease activity [GO:0008408]; 5'-deoxyribose-5-phosphate lyase activity [GO:0051575]; chromatin binding [GO:0003682]; DNA binding [GO:0003677]; DNA-directed DNA polymerase activity [GO:0003887]; protease binding [GO:0002020]; single-stranded DNA 3'-5' DNA exonuclease activity [GO:0008310] | 2.7.7.7; 3.1.11.-; 4.2.99.- | nan | CATALYTIC ACTIVITY: Reaction=DNA(n) + a 2'-deoxyribonucleoside 5'-triphosphate = DNA(n+1) + diphosphate; Xref=Rhea:RHEA:22508, Rhea:RHEA-COMP:17339, Rhea:RHEA-COMP:17340, ChEBI:CHEBI:33019, ChEBI:CHEBI:61560, ChEBI:CHEBI:173112; EC=2.7.7.7; Evidence={ECO:0000269|PubMed:10827171, ECO:0000269|PubMed:11477093, ECO:0000269... | nan | SUBCELLULAR LOCATION: Mitochondrion {ECO:0000269|PubMed:10827171, ECO:0000269|PubMed:18063578}. Mitochondrion matrix, mitochondrion nucleoid {ECO:0000269|PubMed:18063578}. | FUNCTION: Catalytic subunit of DNA polymerase gamma solely responsible for replication of mitochondrial DNA (mtDNA). Replicates both heavy and light strands of the circular mtDNA genome using a single-stranded DNA template, RNA primers and the four deoxyribonucleoside triphosphates as substrates (PubMed:11477093, PubMe... | DOMAIN: The polymerase domain encompasses three conserved active site motifs: Pol A (residues 887-896), Pol B (residues 943-958) and Pol C (residues 1134-1141). Binds the incoming dNTPs and undergoes an open to close coformation change to catalyze the formation of phosphodiester bond. {ECO:0000269|PubMed:26056153, ECO:... | nan | nan |
P52799 | MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSTRNKDPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNILGSEVALFAGIASGCIIFIVIIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQE... | 333 | 36,922.7708 | 9.036872 | 0.084084 | 45.298198 | -0.35015 | 0.249249 | 0.339339 | 0.36036 | 15 | 0.045 | 8 | 0.024 | 17 | 0.051 | 13 | 0.039 | 9 | 0.027 | 25 | 0.075 | 6 | 0.018 | 25 | 0.075 | 24 | 0.072 | 25 | 0.075 | 6 | 0.018 | 18 | 0.054 | 21 | 0.063 | 13 | 0.039 | 15 | 0.045 | 32 | 0.096 | 20 | 0.06 | 22 | 0.066 | 4 | 0.012 | 15 | 0.045 | 333 | 36,921.92 | 8.977 | 0.000243 | P52799 | EFNB2_HUMAN | Ephrin-B2 (EPH-related receptor tyrosine kinase ligand 5) (LERK-5) (HTK ligand) (HTK-L) | Homo sapiens (Human) | 333 | 36,923 | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:28931592}; Single-pass type I membrane protein {ECO:0000255}. Cell junction, adherens junction {ECO:0000250|UniProtKB:P52800}. | adherens junction organization [GO:0034332]; anatomical structure morphogenesis [GO:0009653]; animal organ morphogenesis [GO:0009887]; axon guidance [GO:0007411]; blood vessel morphogenesis [GO:0048514]; cell adhesion [GO:0007155]; cell migration involved in sprouting angiogenesis [GO:0002042]; cell-cell signaling [GO:... | ephrin receptor binding [GO:0046875]; virus receptor activity [GO:0001618] | nan | nan | nan | nan | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:28931592}; Single-pass type I membrane protein {ECO:0000255}. Cell junction, adherens junction {ECO:0000250|UniProtKB:P52800}. | FUNCTION: Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional sign... | nan | nan | nan |
P52789 | MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVALIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIVGTGSNACYMEEMRHIDMVEGDEGRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKEELLF... | 917 | 102,378.7571 | 5.7095 | 0.067612 | 34.933152 | -0.19084 | 0.343511 | 0.254089 | 0.352236 | 57 | 0.062 | 25 | 0.027 | 62 | 0.068 | 73 | 0.08 | 41 | 0.045 | 83 | 0.091 | 26 | 0.028 | 46 | 0.05 | 55 | 0.06 | 92 | 0.1 | 38 | 0.041 | 25 | 0.027 | 21 | 0.023 | 29 | 0.032 | 58 | 0.063 | 42 | 0.046 | 52 | 0.057 | 71 | 0.077 | 6 | 0.007 | 15 | 0.016 | 917 | 102,378.06 | -23.779 | -0.000232 | P52789 | HXK2_HUMAN | Hexokinase-2 (EC 2.7.1.1) (Hexokinase type II) (HK II) (Hexokinase-B) (Muscle form hexokinase) | Homo sapiens (Human) | 917 | 102,380 | SUBCELLULAR LOCATION: Mitochondrion outer membrane {ECO:0000269|PubMed:18350175}; Peripheral membrane protein {ECO:0000305}. Cytoplasm, cytosol {ECO:0000269|PubMed:18350175}. Note=The mitochondrial-binding peptide (MBP) region promotes association with the mitochondrial outer membrane (PubMed:29298880). The interaction... | apoptotic mitochondrial changes [GO:0008637]; canonical glycolysis [GO:0061621]; cellular response to leukemia inhibitory factor [GO:1990830]; establishment of protein localization to mitochondrion [GO:0072655]; fructose 6-phosphate metabolic process [GO:0006002]; glucose 6-phosphate metabolic process [GO:0051156]; glu... | ATP binding [GO:0005524]; D-glucose binding [GO:0005536]; fructokinase activity [GO:0008865]; glucokinase activity [GO:0004340]; hexokinase activity [GO:0004396] | 2.7.1.1 | nan | CATALYTIC ACTIVITY: Reaction=a D-hexose + ATP = a D-hexose 6-phosphate + ADP + H(+); Xref=Rhea:RHEA:22740, ChEBI:CHEBI:4194, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616, ChEBI:CHEBI:229467, ChEBI:CHEBI:456216; EC=2.7.1.1; Evidence={ECO:0000269|PubMed:23185017, ECO:0000269|PubMed:26985301, ECO:0000269|PubMed:29298880}; Physiol... | PATHWAY: Carbohydrate metabolism; hexose metabolism. {ECO:0000305|PubMed:29298880}.; PATHWAY: Carbohydrate degradation; glycolysis; D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose: step 1/4. {ECO:0000305|PubMed:29298880}. | SUBCELLULAR LOCATION: Mitochondrion outer membrane {ECO:0000269|PubMed:18350175}; Peripheral membrane protein {ECO:0000305}. Cytoplasm, cytosol {ECO:0000269|PubMed:18350175}. Note=The mitochondrial-binding peptide (MBP) region promotes association with the mitochondrial outer membrane (PubMed:29298880). The interaction... | FUNCTION: Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D-fructose 6-phosphate, respectively) (PubMed:23185017, PubMed:26985301, PubMed:29298880). Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose... | DOMAIN: The N- and C-terminal halves of the protein contain a hexokinase domain (PubMed:29298880). In contrast to hexokinase-1 and -3 (HK1 and HK3, respectively), both hexokinase domains display catalytic activity (PubMed:29298880). The region connecting the two hexokinase domains is required for the catalytic activity... | nan | nan |
P55157 | MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGKLQDSVGYRISSNVDVALLWRNPDGDDDQLIQITMKDVNVENVNQQRGEKSIFKGKSPSKIMGKENLEALQRPTLLHLIHGKVKEFYSYQNEAVAIENIKRGLASLFQTQLSSGTTNEVDISGNCKVTYQAHQDKVIKIKALDSCKIARSGFTTPNQVLGVSSKATSVTTYKIEDSFVIAVLAEETHNFGLNFLQTIKGKIVSKQKLELKTTEAGPRLMSGKQAAAIIKAVDSKYTAIPIVGQVFQSHCKGCPSLSELWRSTRKYLQPDNL... | 894 | 99,350.0112 | 8.612025 | 0.074944 | 42.001465 | -0.177069 | 0.345638 | 0.269575 | 0.373602 | 63 | 0.07 | 11 | 0.012 | 40 | 0.045 | 60 | 0.067 | 34 | 0.038 | 55 | 0.062 | 15 | 0.017 | 62 | 0.069 | 69 | 0.077 | 98 | 0.11 | 19 | 0.021 | 36 | 0.04 | 26 | 0.029 | 43 | 0.048 | 39 | 0.044 | 84 | 0.094 | 49 | 0.055 | 58 | 0.065 | 4 | 0.004 | 29 | 0.032 | 894 | 99,349.36 | 7.87 | 0.000079 | P55157 | MTP_HUMAN | Microsomal triglyceride transfer protein large subunit | Homo sapiens (Human) | 894 | 99,351 | SUBCELLULAR LOCATION: Endoplasmic reticulum {ECO:0000269|PubMed:16478722, ECO:0000269|PubMed:22236406, ECO:0000269|PubMed:23475612, ECO:0000269|PubMed:26224785}. Golgi apparatus {ECO:0000269|PubMed:16478722}. Note=Colocalizes with P4HB/PDI in the endoplasmic reticulum (PubMed:23475612, PubMed:26224785). {ECO:0000269|Pu... | cholesterol homeostasis [GO:0042632]; chylomicron assembly [GO:0034378]; circadian rhythm [GO:0007623]; establishment of localization in cell [GO:0051649]; lipid metabolic process [GO:0006629]; lipoprotein metabolic process [GO:0042157]; lipoprotein transport [GO:0042953]; low-density lipoprotein particle remodeling [G... | apolipoprotein binding [GO:0034185]; ceramide 1-phosphate transfer activity [GO:1902388]; cholesterol transfer activity [GO:0120020]; lipid binding [GO:0008289]; lipid transporter activity [GO:0005319]; phosphatidylcholine transfer activity [GO:0120019]; phosphatidylethanolamine transfer activity [GO:1904121]; phosphol... | nan | nan | CATALYTIC ACTIVITY: Reaction=a 1,2-diacyl-sn-glycero-3-phosphocholine(in) = a 1,2-diacyl-sn-glycero-3-phosphocholine(out); Xref=Rhea:RHEA:38571, ChEBI:CHEBI:57643; Evidence={ECO:0000269|PubMed:16478722, ECO:0000269|PubMed:8876250}; PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:38572; Evidence={ECO:0000305|PubMed... | nan | SUBCELLULAR LOCATION: Endoplasmic reticulum {ECO:0000269|PubMed:16478722, ECO:0000269|PubMed:22236406, ECO:0000269|PubMed:23475612, ECO:0000269|PubMed:26224785}. Golgi apparatus {ECO:0000269|PubMed:16478722}. Note=Colocalizes with P4HB/PDI in the endoplasmic reticulum (PubMed:23475612, PubMed:26224785). {ECO:0000269|Pu... | FUNCTION: Catalyzes the transport of triglyceride, cholesteryl ester, and phospholipid between phospholipid surfaces (PubMed:15897609, PubMed:16478722, PubMed:22236406, PubMed:23475612, PubMed:25108285, PubMed:26224785, PubMed:8876250, PubMed:8939939). Required for the assembly and secretion of plasma lipoproteins that... | nan | INDUCTION: Positively regulated by cholesterol and negatively regulated by insulin. {ECO:0000269|PubMed:7961826}. | nan |
P54289 | MAAGCLLALTLTLFQSLLIGPSSEEPFPSAVTIKSWVDKMQEDLVTLAKTASGVNQLVDIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLALEAEKVQAAHQWREDFASNEVVYYNAKDDLDPEKNDSEPGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVLNELNWTSALDEVFKKNREEDPSLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQDVSCFQHLVQANVRNKKVLKD... | 1,103 | 124,566.5287 | 5.119681 | 0.104261 | 35.000562 | -0.33282 | 0.285585 | 0.31097 | 0.381686 | 67 | 0.061 | 20 | 0.018 | 77 | 0.07 | 64 | 0.058 | 49 | 0.044 | 65 | 0.059 | 11 | 0.01 | 68 | 0.062 | 66 | 0.06 | 101 | 0.092 | 17 | 0.015 | 77 | 0.07 | 52 | 0.047 | 46 | 0.042 | 48 | 0.044 | 72 | 0.065 | 60 | 0.054 | 77 | 0.07 | 17 | 0.015 | 49 | 0.044 | 1,103 | 124,565.95 | -28.712 | -0.00023 | P54289 | CA2D1_HUMAN | Voltage-dependent calcium channel subunit alpha-2/delta-1 (Voltage-gated calcium channel subunit alpha-2/delta-1) [Cleaved into: Voltage-dependent calcium channel subunit alpha-2-1; Voltage-dependent calcium channel subunit delta-1] | Homo sapiens (Human) | 1,103 | 124,568 | SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Single-pass type I membrane protein {ECO:0000305}. Cell membrane {ECO:0000269|PubMed:35293990}. | calcium ion import across plasma membrane [GO:0098703]; calcium ion transmembrane transport via high voltage-gated calcium channel [GO:0061577]; calcium ion transport [GO:0006816]; calcium ion transport into cytosol [GO:0060402]; cardiac muscle cell action potential involved in contraction [GO:0086002]; cellular respon... | metal ion binding [GO:0046872]; voltage-gated calcium channel activity [GO:0005245] | nan | nan | nan | nan | SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Single-pass type I membrane protein {ECO:0000305}. Cell membrane {ECO:0000269|PubMed:35293990}. | FUNCTION: The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel (PubMed:35293990). Plays an important role in excitation-contraction coupling (By similarity). {ECO:0000250, ECO:0000269|PubMed:35293990}. | DOMAIN: The MIDAS-like motif in the VWFA domain binds divalent metal cations and is required to promote trafficking of the alpha-1 (CACNA1) subunit to the plasma membrane by an integrin-like switch. {ECO:0000250}. | nan | nan |
P53674 | MSQAAKASASATVAVNPGPDTKGKGAPPAGTSPSPGTTLAPTTVPITSAKAAELPPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQEHKISLFEGANFKGNTIEIQGDDAPSLWVYGFSDRVGSVKVSSGTWVGYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQSLRRLRDKQWHLEGSFPVLATEPPK | 252 | 28,023.054 | 8.589203 | 0.123016 | 41.384524 | -0.544841 | 0.269841 | 0.345238 | 0.31746 | 21 | 0.083 | 1 | 0.004 | 10 | 0.04 | 16 | 0.063 | 14 | 0.056 | 24 | 0.095 | 3 | 0.012 | 8 | 0.032 | 11 | 0.044 | 15 | 0.06 | 5 | 0.02 | 9 | 0.036 | 20 | 0.079 | 11 | 0.044 | 17 | 0.067 | 24 | 0.095 | 12 | 0.048 | 14 | 0.056 | 8 | 0.032 | 9 | 0.036 | 252 | 28,022.16 | 2.948 | 0.000105 | P53674 | CRBB1_HUMAN | Beta-crystallin B1 (Beta-B1 crystallin) | Homo sapiens (Human) | 252 | 28,023 | nan | lens development in camera-type eye [GO:0002088]; visual perception [GO:0007601] | structural constituent of eye lens [GO:0005212] | nan | nan | nan | nan | nan | FUNCTION: Crystallins are the dominant structural components of the vertebrate eye lens. | DOMAIN: Has a two-domain beta-structure, folded into four very similar Greek key motifs. | nan | nan |
P52739 | MEAEETMECLQEFPEHHKMILDRLNEQREQDRFTDITLIVDGHHFKAHKAVLAACSKFFYKFFQEFTQEPLVEIEGVSKMAFRHLIEFTYTAKLMIQGEEEANDVWKAAEFLQMLEAIKALEVRNKENSAPLEENTTGKNEAKKRKIAETSNVITESLPSAESEPVEIEVEIAEGTIEVEDEGIETLEEVASAKQSVKYIQSTGSSDDSALALLADITSKYRQGDRKGQIKEDGCPSDPTSKQVEGIEIVELQLSHVKDLFHCEKCNRSFKLFYHFKEHMKSHSTESFKCEICNKRYLRESAWKQHLNCYHLEEGGVSKK... | 623 | 71,421.2119 | 5.101891 | 0.060995 | 52.417207 | -0.6687 | 0.373997 | 0.210273 | 0.314607 | 38 | 0.061 | 18 | 0.029 | 31 | 0.05 | 88 | 0.141 | 24 | 0.039 | 24 | 0.039 | 33 | 0.053 | 26 | 0.042 | 46 | 0.074 | 49 | 0.079 | 12 | 0.019 | 20 | 0.032 | 18 | 0.029 | 36 | 0.058 | 25 | 0.04 | 38 | 0.061 | 36 | 0.058 | 47 | 0.075 | 4 | 0.006 | 10 | 0.016 | 623 | 71,420.43 | -48.391 | -0.000678 | P52739 | ZN131_HUMAN | Zinc finger protein 131 | Homo sapiens (Human) | 623 | 71,422 | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:17306895, ECO:0000269|PubMed:22467880, ECO:0000269|PubMed:23404503}. Note=Sumoylation does not affect nuclear localization. | negative regulation of transcription by RNA polymerase II [GO:0000122]; regulation of cytokine production [GO:0001817]; regulation of immune system process [GO:0002682] | DNA-binding transcription activator activity, RNA polymerase II-specific [GO:0001228]; DNA-binding transcription repressor activity, RNA polymerase II-specific [GO:0001227]; RNA polymerase II cis-regulatory region sequence-specific DNA binding [GO:0000978]; zinc ion binding [GO:0008270] | nan | nan | nan | nan | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:17306895, ECO:0000269|PubMed:22467880, ECO:0000269|PubMed:23404503}. Note=Sumoylation does not affect nuclear localization. | FUNCTION: Plays a role during development and organogenesis as well as in the function of the adult central nervous system (By similarity). May be involved in transcriptional regulation as a repressor of ESR1/ER-alpha signaling. {ECO:0000250, ECO:0000269|PubMed:18847501, ECO:0000269|PubMed:22467880}. | nan | nan | nan |
P52597 | MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTREGRQSGEAFVELGSEDDVKMALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADSANDGFVRLRGLPFGCTKEEIVQFFSGLEIVPNGITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLKFMSVQRPGPYDRPGTARRYIGIVKQAGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSEFTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIE... | 415 | 45,671.3475 | 5.376253 | 0.106024 | 37.882892 | -0.471566 | 0.272289 | 0.33253 | 0.313253 | 26 | 0.063 | 6 | 0.014 | 22 | 0.053 | 33 | 0.08 | 20 | 0.048 | 51 | 0.123 | 13 | 0.031 | 15 | 0.036 | 16 | 0.039 | 24 | 0.058 | 14 | 0.034 | 11 | 0.027 | 17 | 0.041 | 15 | 0.036 | 24 | 0.058 | 37 | 0.089 | 19 | 0.046 | 28 | 0.067 | 2 | 0.005 | 22 | 0.053 | 415 | 45,670.52 | -14.42 | -0.000316 | P52597 | HNRPF_HUMAN | Heterogeneous nuclear ribonucleoprotein F (hnRNP F) (Nucleolin-like protein mcs94-1) [Cleaved into: Heterogeneous nuclear ribonucleoprotein F, N-terminally processed] | Homo sapiens (Human) | 415 | 45,672 | SUBCELLULAR LOCATION: Nucleus, nucleoplasm. | mRNA splicing, via spliceosome [GO:0000398]; regulation of RNA splicing [GO:0043484]; RNA processing [GO:0006396] | RNA binding [GO:0003723]; single-stranded RNA binding [GO:0003727] | nan | nan | nan | nan | SUBCELLULAR LOCATION: Nucleus, nucleoplasm. | FUNCTION: Component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Plays a role in the regulation of alternative splicing events. Binds G-rich sequences in pre-... | DOMAIN: The N-terminal RRM domains are responsible for recognizing the G-tract of BCL-X RNA. | nan | nan |
P54105 | MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH | 237 | 26,215.0243 | 4.050028 | 0.080169 | 49.968819 | -0.656118 | 0.341772 | 0.337553 | 0.299578 | 16 | 0.068 | 3 | 0.013 | 25 | 0.105 | 32 | 0.135 | 9 | 0.038 | 19 | 0.08 | 6 | 0.025 | 5 | 0.021 | 5 | 0.021 | 21 | 0.089 | 7 | 0.03 | 3 | 0.013 | 13 | 0.055 | 9 | 0.038 | 8 | 0.034 | 20 | 0.084 | 14 | 0.059 | 12 | 0.051 | 1 | 0.004 | 9 | 0.038 | 237 | 26,214.13 | -43.219 | -0.001649 | P54105 | ICLN_HUMAN | Methylosome subunit pICln (Chloride channel, nucleotide sensitive 1A) (Chloride conductance regulatory protein ICln) (I(Cln)) (Chloride ion current inducer protein) (ClCI) (Reticulocyte pICln) | Homo sapiens (Human) | 237 | 26,215 | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000269|PubMed:18984161, ECO:0000269|PubMed:21081503}. Nucleus {ECO:0000269|PubMed:18984161, ECO:0000269|PubMed:21081503}. Cytoplasm, cytoskeleton {ECO:0000269|PubMed:18984161}. Note=A small fraction is also associated with the cytoskeleton (PubMed:18984161). | cell volume homeostasis [GO:0006884]; chloride transport [GO:0006821]; mRNA cis splicing, via spliceosome [GO:0045292]; positive regulation of mRNA splicing, via spliceosome [GO:0048026]; spliceosomal snRNP assembly [GO:0000387] | RNA binding [GO:0003723] | nan | nan | nan | nan | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000269|PubMed:18984161, ECO:0000269|PubMed:21081503}. Nucleus {ECO:0000269|PubMed:18984161, ECO:0000269|PubMed:21081503}. Cytoplasm, cytoskeleton {ECO:0000269|PubMed:18984161}. Note=A small fraction is also associated with the cytoskeleton (PubMed:18984161). | FUNCTION: Involved in both the assembly of spliceosomal snRNPs and the methylation of Sm proteins (PubMed:10330151, PubMed:11713266, PubMed:18984161, PubMed:21081503). Chaperone that regulates the assembly of spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosom... | nan | nan | nan |
P53701 | MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS | 268 | 30,601.2463 | 6.248902 | 0.104478 | 60.752239 | -0.733955 | 0.309701 | 0.320896 | 0.279851 | 23 | 0.086 | 7 | 0.026 | 14 | 0.052 | 21 | 0.078 | 5 | 0.019 | 14 | 0.052 | 5 | 0.019 | 13 | 0.049 | 18 | 0.067 | 12 | 0.045 | 9 | 0.034 | 13 | 0.049 | 24 | 0.09 | 9 | 0.034 | 15 | 0.056 | 21 | 0.078 | 9 | 0.034 | 13 | 0.049 | 12 | 0.045 | 11 | 0.041 | 268 | 30,600.36 | -1.896 | -0.000062 | P53701 | CCHL_HUMAN | Holocytochrome c-type synthase (EC 4.4.1.17) (Cytochrome c-type heme lyase) | Homo sapiens (Human) | 268 | 30,602 | SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000305|PubMed:17033964}. Membrane {ECO:0000269|PubMed:23150584}; Lipid-anchor {ECO:0000305|PubMed:25255805, ECO:0000305|PubMed:25807930}. | animal organ morphogenesis [GO:0009887]; cytochrome c-heme linkage [GO:0018063]; respiratory electron transport chain [GO:0022904] | heme binding [GO:0020037]; holocytochrome-c synthase activity [GO:0004408]; metal ion binding [GO:0046872] | 4.4.1.17 | nan | CATALYTIC ACTIVITY: Reaction=holo-[cytochrome c] = apo-[cytochrome c] + heme b; Xref=Rhea:RHEA:22648, Rhea:RHEA-COMP:10725, Rhea:RHEA-COMP:10726, ChEBI:CHEBI:29950, ChEBI:CHEBI:60344, ChEBI:CHEBI:83739; EC=4.4.1.17; Evidence={ECO:0000269|PubMed:23150584}; PhysiologicalDirection=right-to-left; Xref=Rhea:RHEA:22650; Evid... | nan | SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000305|PubMed:17033964}. Membrane {ECO:0000269|PubMed:23150584}; Lipid-anchor {ECO:0000305|PubMed:25255805, ECO:0000305|PubMed:25807930}. | FUNCTION: Lyase that catalyzes the covalent linking of the heme group to the cytochrome C apoprotein to produce the mature functional cytochrome. {ECO:0000269|PubMed:23150584}. | nan | nan | nan |
P51970 | MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK | 172 | 20,104.8154 | 7.578366 | 0.098837 | 55.724477 | -0.764535 | 0.337209 | 0.244186 | 0.313953 | 9 | 0.052 | 8 | 0.047 | 11 | 0.064 | 16 | 0.093 | 8 | 0.047 | 8 | 0.047 | 6 | 0.035 | 5 | 0.029 | 16 | 0.093 | 15 | 0.087 | 2 | 0.012 | 3 | 0.017 | 14 | 0.081 | 7 | 0.041 | 12 | 0.07 | 6 | 0.035 | 8 | 0.047 | 9 | 0.052 | 4 | 0.023 | 5 | 0.029 | 172 | 20,103.89 | 1.001 | 0.00005 | P51970 | NDUA8_HUMAN | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 (Complex I-19kD) (CI-19kD) (Complex I-PGIV) (CI-PGIV) (NADH-ubiquinone oxidoreductase 19 kDa subunit) | Homo sapiens (Human) | 172 | 20,105 | SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000269|PubMed:21310150}; Peripheral membrane protein {ECO:0000269|PubMed:21310150}. Mitochondrion intermembrane space {ECO:0000269|PubMed:21310150}. Mitochondrion {ECO:0000269|PubMed:23676665}. | aerobic respiration [GO:0009060]; mitochondrial electron transport, NADH to ubiquinone [GO:0006120]; proton motive force-driven mitochondrial ATP synthesis [GO:0042776] | NADH dehydrogenase (ubiquinone) activity [GO:0008137]; protein-containing complex binding [GO:0044877] | nan | nan | nan | nan | SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000269|PubMed:21310150}; Peripheral membrane protein {ECO:0000269|PubMed:21310150}. Mitochondrion intermembrane space {ECO:0000269|PubMed:21310150}. Mitochondrion {ECO:0000269|PubMed:23676665}. | FUNCTION: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis (PubMed:27626371, PubMed:32385911, PubMed:33153867). Complex I functions in the transfer of electrons from NADH to the respiratory chain (PubMed:27626371). The imm... | DOMAIN: Contains four C-X9-C motifs that are predicted to form a helix-coil-helix structure, permitting the formation of intramolecular disulfide bonds. {ECO:0000305|PubMed:21310150}. | nan | nan |
P51970 | MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK | 172 | 20,104.8154 | 7.578366 | 0.098837 | 55.724477 | -0.764535 | 0.337209 | 0.244186 | 0.313953 | 9 | 0.052 | 8 | 0.047 | 11 | 0.064 | 16 | 0.093 | 8 | 0.047 | 8 | 0.047 | 6 | 0.035 | 5 | 0.029 | 16 | 0.093 | 15 | 0.087 | 2 | 0.012 | 3 | 0.017 | 14 | 0.081 | 7 | 0.041 | 12 | 0.07 | 6 | 0.035 | 8 | 0.047 | 9 | 0.052 | 4 | 0.023 | 5 | 0.029 | 172 | 20,103.89 | 1.001 | 0.00005 | Q0MQB1 | NDUA8_PANTR | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 (Complex I-19kD) (CI-19kD) (NADH-ubiquinone oxidoreductase 19 kDa subunit) | Pan troglodytes (Chimpanzee) | 172 | 20,105 | SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000250|UniProtKB:P51970}; Peripheral membrane protein {ECO:0000250|UniProtKB:P51970}. Mitochondrion intermembrane space {ECO:0000250|UniProtKB:P51970}. Mitochondrion {ECO:0000250|UniProtKB:P51970}. | mitochondrial electron transport, NADH to ubiquinone [GO:0006120] | protein-containing complex binding [GO:0044877] | nan | nan | nan | nan | SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000250|UniProtKB:P51970}; Peripheral membrane protein {ECO:0000250|UniProtKB:P51970}. Mitochondrion intermembrane space {ECO:0000250|UniProtKB:P51970}. Mitochondrion {ECO:0000250|UniProtKB:P51970}. | FUNCTION: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. ... | DOMAIN: Contains four C-X9-C motifs that are predicted to form a helix-coil-helix structure, permitting the formation of intramolecular disulfide bonds. {ECO:0000250|UniProtKB:P51970}. | nan | nan |
P51970 | MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK | 172 | 20,104.8154 | 7.578366 | 0.098837 | 55.724477 | -0.764535 | 0.337209 | 0.244186 | 0.313953 | 9 | 0.052 | 8 | 0.047 | 11 | 0.064 | 16 | 0.093 | 8 | 0.047 | 8 | 0.047 | 6 | 0.035 | 5 | 0.029 | 16 | 0.093 | 15 | 0.087 | 2 | 0.012 | 3 | 0.017 | 14 | 0.081 | 7 | 0.041 | 12 | 0.07 | 6 | 0.035 | 8 | 0.047 | 9 | 0.052 | 4 | 0.023 | 5 | 0.029 | 172 | 20,103.89 | 1.001 | 0.00005 | Q0MQB0 | NDUA8_GORGO | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 (Complex I-19kD) (CI-19kD) (NADH-ubiquinone oxidoreductase 19 kDa subunit) | Gorilla gorilla gorilla (Western lowland gorilla) | 172 | 20,105 | SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000250|UniProtKB:P51970}; Peripheral membrane protein {ECO:0000250|UniProtKB:P51970}. Mitochondrion intermembrane space {ECO:0000250|UniProtKB:P51970}. Mitochondrion {ECO:0000250|UniProtKB:P51970}. | mitochondrial electron transport, NADH to ubiquinone [GO:0006120] | nan | nan | nan | nan | nan | SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000250|UniProtKB:P51970}; Peripheral membrane protein {ECO:0000250|UniProtKB:P51970}. Mitochondrion intermembrane space {ECO:0000250|UniProtKB:P51970}. Mitochondrion {ECO:0000250|UniProtKB:P51970}. | FUNCTION: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. ... | DOMAIN: Contains four C-X9-C motifs that are predicted to form a helix-coil-helix structure, permitting the formation of intramolecular disulfide bonds. {ECO:0000250|UniProtKB:P51970}. | nan | nan |
P51956 | MDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAVLLAKMKHPNIVAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMAFACTYVGTPYYVPPEIWENLPYNNKSDIWSLGCILYELCTLKHPFQANSWKNLILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQKCLPPEIIMEYGEEVLEEIKNSKHNTPRKKTNPSRIRIALGNEASTVQEEEQDRKGSH... | 506 | 57,704.0016 | 6.724473 | 0.075099 | 46.920949 | -0.605534 | 0.34585 | 0.296443 | 0.328063 | 24 | 0.047 | 9 | 0.018 | 25 | 0.049 | 44 | 0.087 | 16 | 0.032 | 29 | 0.057 | 14 | 0.028 | 26 | 0.051 | 40 | 0.079 | 54 | 0.107 | 13 | 0.026 | 31 | 0.061 | 25 | 0.049 | 19 | 0.038 | 27 | 0.053 | 40 | 0.079 | 24 | 0.047 | 24 | 0.047 | 8 | 0.016 | 14 | 0.028 | 506 | 57,703.2 | -1.83 | -0.000032 | P51956 | NEK3_HUMAN | Serine/threonine-protein kinase Nek3 (EC 2.7.11.1) (HSPK 36) (Never in mitosis A-related kinase 3) (NimA-related protein kinase 3) | Homo sapiens (Human) | 506 | 57,705 | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. Cell projection, axon {ECO:0000250}. | cell division [GO:0051301]; mitotic cell cycle [GO:0000278]; protein phosphorylation [GO:0006468] | ATP binding [GO:0005524]; metal ion binding [GO:0046872]; protein serine kinase activity [GO:0106310]; protein serine/threonine kinase activity [GO:0004674] | 2.7.11.1 | nan | CATALYTIC ACTIVITY: Reaction=L-seryl-[protein] + ATP = O-phospho-L-seryl-[protein] + ADP + H(+); Xref=Rhea:RHEA:17989, Rhea:RHEA-COMP:9863, Rhea:RHEA-COMP:11604, ChEBI:CHEBI:15378, ChEBI:CHEBI:29999, ChEBI:CHEBI:30616, ChEBI:CHEBI:83421, ChEBI:CHEBI:456216; EC=2.7.11.1; CATALYTIC ACTIVITY: Reaction=L-threonyl-[protein]... | nan | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. Cell projection, axon {ECO:0000250}. | FUNCTION: Protein kinase which influences neuronal morphogenesis and polarity through effects on microtubules. Regulates microtubule acetylation in neurons. Contributes to prolactin-mediated phosphorylation of PXN and VAV2. Implicated in prolactin-mediated cytoskeletal reorganization and motility of breast cancer cells... | nan | nan | nan |
P51946 | MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLV... | 323 | 37,643.0253 | 6.726065 | 0.095975 | 50.644923 | -0.378947 | 0.393189 | 0.232198 | 0.362229 | 20 | 0.062 | 8 | 0.025 | 14 | 0.043 | 31 | 0.096 | 14 | 0.043 | 7 | 0.022 | 8 | 0.025 | 14 | 0.043 | 24 | 0.074 | 42 | 0.13 | 10 | 0.031 | 15 | 0.046 | 15 | 0.046 | 10 | 0.031 | 20 | 0.062 | 24 | 0.074 | 13 | 0.04 | 17 | 0.053 | 2 | 0.006 | 15 | 0.046 | 323 | 37,642.15 | -0.93 | -0.000025 | P51946 | CCNH_HUMAN | Cyclin-H (MO15-associated protein) (p34) (p37) | Homo sapiens (Human) | 323 | 37,643 | SUBCELLULAR LOCATION: Nucleus. | protein stabilization [GO:0050821]; regulation of G1/S transition of mitotic cell cycle [GO:2000045]; regulation of transcription by RNA polymerase II [GO:0006357]; transcription initiation at RNA polymerase II promoter [GO:0006367] | cyclin-dependent protein serine/threonine kinase regulator activity [GO:0016538]; kinase activity [GO:0016301] | nan | nan | nan | nan | SUBCELLULAR LOCATION: Nucleus. | FUNCTION: Regulates CDK7, the catalytic subunit of the CDK-activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of th... | nan | nan | nan |
End of preview. Expand in Data Studio
README.md exists but content is empty.
- Downloads last month
- 4