Dataset Viewer
Auto-converted to Parquet Duplicate
sequence
stringlengths
13
8.92k
annotation
listlengths
2
214
description
stringlengths
61
12.1k
labels
int64
0
0
MELITNELLYKTYKQKPVGVEEPVYDQAGDPLFGERGAVHPQSTLKLPHKRGERDVPTNLASLPKRGDCRSGNSRGPVSGIYLKPGPLFYQDYKGPVYHRAPLELFEEGSMCETTKRIGRVTGSDGKLYHIYVCIDGCIIIKSATRSYQRVFRWVHNRLDCPLWVTTCSDTKEEGATKKKTQKPDRLERGKMKIVPKESEKDSKTKPPDATIVVEGVKYQVRKKGKTKSKNTQDGLYHNKNKPQESRKKLEKALLAWAIIAIVLFQVTMGENITQWNLQDNGTEGIQRAMFQRGVNRSLHGIWPEKICTGVPSHLATDIE...
[ 3730, 4587, 4666, 5058, 5174, 5943, 8200, 10917, 10922, 10930, 12938, 13919, 13935, 13963, 13984, 14664, 19487, 25325, 25809, 26294, 26300, 26481, 27616, 27904, 27925, 27926, 28055, 28223, 28227, 29033, 29034, 29906, 30398, 31393, 31535, 32073, ...
The following text describes a protein: Function: [N-terminal protease]: Leader cysteine autoprotease that cleaves itself from the nascent polyprotein during translation of the viral mRNA. Once released, plays a role in the inhibition of host innate immune response by interacting with host IRF3 and inducing its proteas...
0
MTCLGLSRPSKRVADEAGNFSPLGQACGCRALRFLKGKVSVLLATALPANVAFLCCRGSQAKPRRRSRSGWRSEQPWMPFVPKWTLPTGLNVSIECKRVSGLEPATVDWAFDLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLMANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDDSSPSMSGCCGEDCSYEILSRRTKFGDSQHSHADHGFLIPLTQGDQKEPPVFIPCKVSSVYIVSFQSLDAWHQLVKGCLVPYPAHPSL...
[ 2605, 24917, 24978, 29733, 32329, 35846, 36091, 49230, 67196, 87125, 87367, 87735, 87821, 87857, 88008, 88153 ]
The following text describes a protein: Function: N-alpha-acetyltransferase that specifically mediates the acetylation of the N-terminal residues of histones H4 and H2A. In contrast to other N-alpha-acetyltransferase, has a very specific selectivity for histones H4 and H2A N-terminus and specifically recognizes the 'Se...
0
MPSLPQEGVIQGPSPLDLNTELPYQSTMKRKVRKKKKKGTITANVAGTKFEIVRLVIDEMGFMKTPDEDETSNLIWCDSAVQQEKISELQNYQRINHFPGMGEICRKDFLARNMTKMIKSRPLDYTFVPRTWIFPAEYTQFQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGDKLPSQDHLIVQEYIEKPFLMEGYKFDLRIYILVTSCDPLKIFLYHDGLVRMGTEKYIPPNESNLTQLYMHLTNYSVNKHNEHFERDETENKGSKRSIKWFTEFLQANQHDVAKFWSDISELVVKTLIVAEPHVLHAYRMCRPG...
[ 6409, 6686, 8828, 10809, 11620, 25040, 25069, 25495, 26070, 26218, 29033, 30063, 32115, 32536, 33240, 34356, 39520, 87016, 87103, 87110, 87139, 87278, 87311, 87367, 87371, 87402, 87407, 87722, 87747, 87767, 87782, 87829, 87855, 87976, 88008 ]
The following text describes a protein: Function: Polyglutamylase which modifies tubulin, generating polyglutamate side chains of variable lengths on the gamma-carboxyl group of specific glutamate residues within the C-terminal tail of tubulin. Mediates both ATP-dependent initiation and elongation steps of the polyglut...
0
MPSNPNRSIYDFYNITDIIGEGTFSTVTLANHIEKIEDKYAIKIISKEVLDNERRTYVDWEISILSKCQHPNIIKFYEHYESDEDICLVLEWIPNGDLFDRIVKKGVFNEEEARLTMKSLLSAVEYLHDKSVVHRDIKPENILFSDSYGGIKLGDFGLAKFYEESIGLELACGTLAYSAPEITNNQVYRKSVDMWSCGCILYFILFGRPPFYSDDESEMFELITKGQWEFPSKTQHKYSDQVKDLIKLLLENDPNKRLTVKQSLAHKWIQSIDERSFSSVIKQSPLITSQQQQQQSPSSLLSSSSSSTASSPSLKPLSPL...
[ 3613, 8175, 8663, 24978, 28524, 28531, 29033, 36535, 42974, 45290, 50333, 59889, 87110, 87694, 87855, 88008, 88052, 88153 ]
The following text describes a protein: Function: May phosphorylate a specific serine in the N-terminus of a myosin light chain.
0
MGKAEESGRKETQQSISMQVMNLPRDLLQRFMSSSNHFSQNGETEEEEQEEEIELSLGLSLNGRFGVDPKAKKLTRSSSIPDFINNTNESSSSPSYLFPMACGSLVRTCSLPVETEEEWRKRKEIQSLRRLAAKRKRSEKQKNLKALKDKNREGLGEENCDEDKKEEGWVNGGRGPLMAASQGSIGSQGSGSSGISELDSQPPQGTYKCQGSRSPTSVQSTTQTEQKPNIINPGKISTQKSEKLAGITAKNQHNQPGVDEKRLRASLKNIMEDMPCVSTTGDGPNGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVK...
[ 8663, 9429, 15387, 24917, 46376, 60221, 61078, 61080, 87857, 88008 ]
The following text describes a protein: Function: Acts as a negative regulator of abscisic acid (ABA) response. Subcellular Localization: Nucleus.
0
MVEMLPTVVALVLAVSVVAKDNTTCDGPCGLRFRQNPQAGIRIVGGQTSSPGAWPWMVSLQIFTSHNSRRYHACGGSLLNSHWVLTAAHCFDNKKKVYDWRLVFGAHEIEYGRNKPVKEPQQERYVQKIVIHEKYNAVTEGNDIALLKVTPPVTCGDFVGPGCLPHFKSGPPRIPHTCYVTGWGYIKDNAPRPSPVLMEARVDLIDLDLCNSTQWYNGRVTSTNVCAGYPEGKIDTCQGDSGGPLMCRDSVDSPFVIVGITSWGVGCARAKRPGVYTATWDYLDWIASKIGPTALHLIQPATPHPPTTQQPVISFHPPSI...
[ 4573, 7176, 8200, 8682, 8781, 8782, 8783, 8784, 11624, 16171, 24841, 25022, 25807, 26205, 28105, 28227, 29039, 29144, 29147, 32076, 36986, 37036, 43583, 46236, 50917, 61632, 69992, 87413, 87522, 87601, 87965, 88008, 88049, 88058, 88264 ]
The following text describes a protein: Function: Acrosin is the major protease of mammalian spermatozoa. It is a serine protease of trypsin-like cleavage specificity, it is synthesized in a zymogen form, proacrosin and stored in the acrosome.
0
MQLYLVLLLISYLLTPIGASILGRCTVAKMLYDGGLNYFEGYSLENWVCLAYFESKFNPSAVYEDPQDGSTGFGLFQIRDNEWCGHGKNLCSVSCTALLNPNLKDTIQCAKKIVKGKHGMGAWPIWSKNCQLSDVLDRWLDGCDL
[ 8781, 9332, 24841, 24907, 26074, 27944, 36747, 37535, 52289, 55152, 87278, 87311, 87369, 87413, 87461, 87468, 88008, 88038, 88058 ]
The following text describes a protein: Function: May be involved in fertilization. Has no detectable bacteriolytic in vitro. Has no lysozyme activity in vitro (By similarity). Subcellular Localization: Secreted. Cytoplasmic vesicle, secretory vesicle, acrosome. Cell projection, cilium, flagellum. Note=Found in the pri...
0
MTKQAEETQKPIIFAPETYQYDKFTLNEKQLTDDPIDLFTKWFNEAKEDPRETLPEAITFSSAELPSGRVSSRILLFKELDHRGFTIYSNWGTSRKAHDIATNPNAAIVFFWKDLQRQVRVEGITEHVNRETSERYFKTRPRGSKIGAWASRQSDVIKNREELDELTQKNTERFKDAEDIPCPDYWGGLRIVPLEIEFWQGRPSRLHDRFVYRRKTENDPWKVVRLAP
[ 1783, 9110, 9313, 24987, 28563, 29679, 36483, 45707, 46284, 52100, 52242, 87005, 87103, 87456, 87470, 87684, 87785, 87873, 87987, 88008, 88180 ]
The following text describes a protein: Function: Catalyzes the oxidation of either pyridoxine 5'-phosphate (PNP) or pyridoxamine 5'-phosphate (PMP) into pyridoxal 5'-phosphate (PLP). Subcellular Localization: Mitochondrion intermembrane space.
0
MECVKQLCRNHLRLDNLTDPVRSVLTKGTTAEKVQLAACCLGVVCSIICLALGIAAAAVGVSCGGFALGLGIIAILLGIVLFATSALDVLENHGLVGCPFKLPCKSSPANEPAVQFFKGKNGSADQVILVTQ
[ 24878, 25884, 27248, 63047, 87586, 87760, 88038, 88159, 88161, 88240 ]
The following text describes a protein: Function: Inclusion membrane protein probably involved in early modification events of the chlamydial inclusion. Subcellular Localization: Secreted. Host vacuole, host pathogen-containing vacuole, host pathogen-containing vacuole membrane; Multi-pass membrane protein. Note=Secret...
0
MSGQGEDDSDISEEFSGEENEGWDEDISDEDDVIDEEEEEEEEETNQMEEAGRNIQQLAKRVLEDEETTDQPPTKSVRTGKPDLYRPPTNEEMNQLKETENLFQSSLFRMQIEELVSEVTPKNKKSPALDKVLHSLNEIVMKLPKTDSKELTDQSWLPSNVKVPIQQSPYQVKGHFHFAPPTSMKVVGSYLLGFCTKPGMNVDVLLEIPKECLQAKDYLNHRYHRKRALYLACLAASLDKQDLFTSVMFTFFHQDCNKPVILLKPSGKAGKHYTIRLHACPPEGFFKPSRFHPDKNNIRSDWYMGKGRDQDSEPPTPHYN...
[ 8109, 8137, 24957, 25726, 25779, 25922, 27925, 40606, 63018, 63231, 63232, 63233, 63234, 63235, 87306, 87857, 88001, 88008 ]
The following text describes a protein: Function: Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associate with the nascent pre-rR...
0
MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISNIDLNSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFRVVDMVDVTEDFLAKAKTYLGEEGKRVRNYFCCGLQDFSPEPGSYDVIWIQWVIGHLTDQHLAEFLRRCKRGLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLEVVRRIIRTAGLSLLAEERQENLPDEIYHVYSFALR
[ 2213, 8596, 8603, 10797, 10798, 10799, 13411, 13412, 24917, 24926, 25040, 29169, 32000, 34422, 43232, 59229, 87115, 87777, 87857, 88008, 88026, 88153 ]
The following text describes a protein: Function: Distributive alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Gly/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of the exposed alpha-amino group of...
0
MSVKSAAMRDAADSEEFEDMSEDYEEASDASYEYEEGSDDDACHMDAAHGDAGPSSSAGPGWSVLNQDAIVKLQAEAVADVVAILGVKSSVAKTVLMYFRWDKEALMSKVAERDPESVLKQAGVAITDAGSAGPNGQQGGPIMCRVCFTDTEQAETTSMDCGHAFCNDCWRQHFKTQIGEGQARTIRCMAPKCGVVCDEEKVCSLLKSDPAASSSTAAGSGSAGPSGSAGASGSAGTSGSGREPNEALDKYKHSMALSYVEDNARVNFCPSVPWCGHAVQVDGDPFVEPECSCGKVFCFKCLKDPHTPCTCKMWDEWDEK...
[ 2746, 8202, 10753, 24729, 24978, 29166, 31138, 34103, 37468, 38301, 46929, 51583, 60177, 70370, 72000, 74773, 87767, 88008, 88009, 88153, 88181, 88261, 88263 ]
The following text describes a protein: Function: Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.
0
MEELSWTNVHSQDIQIEAESFWRAIDIWWLKPQVINRRISASVEQHKISGLSESTAAGSLAELSRVTPAVRLHEQWLFSLLNDLKHLTSQEENTTSISFEKCIDHHVSLLEESKNETMSNNQVSKCESGSVGEEKVTEQVAEIVTDNHTGEMENEESLLLDKSKMCVICIRKLLPRRASDAVVHEVGIFDHERNEATFTLLECGSKEAKFPSYKFSFQCSRISLHVDDNYKSAPYSSSIPSIEWLGNTLAPKLTKWASEIVGSGQVVVVKPLVPMDRYTELYREMKQKYGTEFVKIWPENTDPQKFVYEDVAIATYLILL...
[ 2180, 11739, 24978, 29166, 30158, 35613, 36409, 45777, 87367, 87767, 87777, 88008, 88026, 88153, 88261, 88263, 88278 ]
The following text describes a protein: Function: Adenosyl-L-methionine (AdoMet)-dependent tRNA (uracil-O(2)-)-methyltransferase. Subcellular Localization: Cytoplasm.
0
MHCRAHTVSAMPPSSPLVKLPLLPRGLLSYLPASILPSSGRESTITPTTSSPSTPPQPAPPSPKKMSSSPGQQQQAGSGGGKADSAELARVFELFDKNGDGRITREELEESLGKLGMSVPGDELASMIARIDANGDGCVDVEEFGELYRAIMAGDGGRAGGEGAGAGEEGAGGEDADEDMREAFRVFDANGDGYITVDELGAVLSSLGLKQGRTAEECRRMIGRVDRDGDGRVDFHEFRQMMRAGGLATLG
[ 26225, 29025, 37640, 46081, 51011, 87244, 87767, 88008, 88009 ]
The following text describes a protein: Function: Potential calcium sensor.
0
MAGITGVMNMKLAARPSSGRHSRGCRPAVVPSAGKQMLLVRRHPPGSASWPTRATGGGGGGVPAGATAADSSGQAKEEEEEDRASRNTSSFEPSIWGDFFLTYSSPLATSSAQKARMVHRAEQLKKQVAKLIAASGACSLYHRIHLVDALERLCLDYLFEDEINDMVTQIHNVDVSGCDLQTVAMWFYLLRNHGYRVSSDVVFAKFRDEQGGFAANNPRDLLNLYNAACLRTHGETILDEAASFTSKCLKSLAPYTYMEASLASEIKRALEIPLPRSVRIYGAKSRIAEYGNQTEANELVLELAKLNYNLVQLQHQEELK...
[ 5620, 5635, 5637, 5638, 5675, 5686, 9350, 10642, 10645, 25225, 27681, 29710, 33596, 33597, 35032, 37526, 40676, 43535, 43545, 62779, 64688, 71056, 75803, 87016, 87017, 87139, 87296, 87321, 87741, 87747, 87752, 87767, 87930, 88008, 88154 ]
The following text describes a protein: Function: Component of the volatile terpenes biosynthesis pathways. Mediates the synthesis of a blend of monoterpenes. Converts mainly geranyl diphosphate to alpha-terpineol. Also triggers the biosynthesis of minor monoterpenes including limonene, gamma-terpinene, beta-myrcene, t...
0
MKSRKVKSVRPGRGRILGLTDVTPSTSLPPLVEGQVRSFLQVTVSKILWTVPKPPPSVLVRLRWWGETANGTVFRPRDSSQTEQKGAKTTTRYAVRCGPKQFTSYLTDMGMLVFEVMTKLDHFPIGRAQISGIAQLSLAHPVSGFFTIVSPTSEKLGELQVSVQLEPLPETYDSSSSAPNTDISFDHASESYGKALTGHPTTMNDPPQPIILSLASADKRESESSSRVTTPRGRDHLYFQENADPGKDSYRGTQDHVTVGWSNVTEGVQSIKPIYSEGTTAGKDALTVNSGPATKDLLSALLDQGSKLRDAMVVSALKSS...
[ 18103, 18977, 23543, 24978, 25027, 25108, 25920, 35959, 63695, 65368, 87278, 87311, 87312, 87367, 87371, 88008, 88009 ]
The following text describes a protein: Function: Component of the centrioles that acts as a positive regulator of centriole elongation. Promotes assembly of centriolar distal appendage, a structure at the distal end of the mother centriole that acts as an anchor of the cilium. Required for primary cilium formation (By...
0
MIAPRLSMPAIVNAQSLVAKLRQLNCEKNYCHPNNLPGFTASAFYKESSSPLDQLVQTARLCHWLLSQLGISVQGVSEFDDPIAISTDLLVACKDIVNVANIPPHRIRMGYGDDLTALVLGIADACLAKLQPNIVSWKSLGSENANAGVERDNDDDDAPILDDLIVDDALIGTMTAKKGTFTTAAGLATGSLTTDSGCIAPGLISEADWEQELMAVDSQLGGKQLGGVYAGQDWRKDVVSMSLLAKALSKETGSCAQSISGLVTDFGKQLERISTREQHLNSQVGQYSAKLGDANRTHAGVTEELAELSQSISALTGELS...
[ 13491, 14057, 17404, 23543, 25018, 25028, 25108, 25109, 25564, 26070, 26954, 26989, 27615, 52063, 87278, 87311, 87312, 87367, 87371, 87468, 88008 ]
The following text describes a protein: Function: Component of the intraflagellar transport complex B (IFT-B) involved in flagellar assembly (Probable). Subcellular Localization: Cell projection, cilium, flagellum. Cytoplasm, cytoskeleton, flagellum axoneme. Cytoplasm, cytoskeleton, flagellum basal body. Note=Localizes...
0
MASIKYNIPKDGKLGFRLAESEPKFNWRNNPRIADCRRLVTNSIQVHLVQNASMNFAPEIPALAAYLENQLFKDALSENDYMDREKLLIRVQNLINLRWTSAQHEPMHATTSLPTYVSAPTLGMKSNLINKPLCDQYTIADTGCMLDRAPKLLADVPRSSIYGSQKCMLEANLWQPELVPPNNHFSGMGFSNAESGDSGITYSGLQYDSEASFESHRYKYQDSTKGEANFDIFNDMNSPSVHTSAMARENLKFEVSSVSDGLYMRQPVLGSLQLKQQLSCLESHSDGRFGENESLGSLPVQNRNLYALPGTTSTSSNTQQ...
[ 2673, 15427, 24715, 24917, 24936, 27922, 28307, 29166, 31126, 36103, 36296, 37576, 45292, 46929, 47005, 52278, 60193, 63699, 69834, 87123, 87125, 87302, 87767, 87857, 88008, 88148, 88150, 88153, 88261, 88263 ]
The following text describes a protein: Function: Acetyltransferase enzyme. Acetylates histones, giving a specific tag for transcriptional activation. Subcellular Localization: Nucleus.
0
MAMLSTASVSGSVDLPRGTMKVDSSASPEVVSDLPPSSPKGSPDRHDPSTSSPSPSRGGDNQSEVISKSEEYRQLFRLPADEILVQDFNCACQESILMQGHMYLFIHYICFYSNIFGYETKKIIPFAEISCVKRAKTAGIFPNAIEILAGGKKYFFASFLSRDEAFKLIHDGWLEYGSAVKSEGEILVTEPQVSDGVVKRARSSMDLANELDIPVRDETLHLSSSSSLPVISQNGVPPSSVQRHAEPDVDVVAANTFNWKPEDTDAPKLSSDFTKVAEAKFSIPVEEFFRLFFSDGAVSFVESFHKNCGDKEFRCTSWQP...
[ 9358, 9420, 9441, 9515, 14335, 14481, 24878, 25008, 25225, 25325, 39372, 46082, 60823, 87170, 87296, 87326, 87441, 87522, 87604, 87760, 87925, 87930, 88008, 88154, 88159, 88161 ]
The following text describes a protein: Function: Involved in ethylene- and salicylic acid-dependent cell death control associated with cells in the vicinity of vascular bundles. Subcellular Localization: Membrane; Single-pass membrane protein. Plastid, chloroplast.
0
MTSRDQLVQQVLRDLQEAVESEGLEGLIGAALEAKQVLSSFTLPICQKGGPGAQVLEVDSVALSLYPEDAPRNMLPLVCKGEGSLLFEATSLLLWGHTGLSLELRARTVVEMLLHRHYYLQGMIDSKVMLQAVRYSLCSEESPEMTNLSFATLEAIFDADVKATCFPTSFSNVWHLYALASILECNIYSIYPMRNIKIRPYFNRVIMPRCSTHVTSMLHIMWAGQPLTSHLFRHQYFAPVVGLEEVEADCTASLNPVPPNLGPLLPPAKTLELLNREPGLSYSHLCDRISITKSTFYRWRRQTQEHRQKVATRFSAKHFL...
[ 8103, 24917, 27904, 66283, 73242, 87384, 87402, 87857, 88008, 88148, 88150 ]
The following text describes a protein: Function: Acts as a transcription factor that regulates development of thoracic vertebrae. Subcellular Localization: Nucleus.
0
MAPSSPSPAAPTRVSGRKRAAKAEEIHQNKEEEEEVAAASSAKRSRKAASSGKKPKSPPKQAKPGRKKKGDAEMKEPVEDDVCAEEPDEEELAMGEEEAEEQAMQEEVVAVAAGSPGKKRVGRRNAAAAAGDHEPEFIGSPVAADEARSNWPKRYGRSTAAKKPDEEEELKARCHYRSAKVDNVVYCLGDDVYVKAGENEADYIGRITEFFEGTDQCHYFTCRWFFRAEDTVINSLVSISVDGHKHDPRRVFLSEEKNDNVLDCIISKVKIVHVDPNMDPKAKAQLIESCDLYYDMSYSVAYSTFANISSENGQSGSDTA...
[ 2339, 12244, 14787, 24917, 27904, 27908, 28004, 36732, 36794, 37213, 49245, 50919, 55524, 59229, 69840, 76045, 87103, 87302, 87384, 87777, 87857, 88008, 88026, 88148, 88150, 88153 ]
The following text describes a protein: Function: Involved in the CpXpG methylation and in gene silencing. Subcellular Localization: Nucleus.
0
MEGRPPKSPTRRRLPQSPTRGRALGSPSTCGRAPGSPSTCGGGRSPGSPSTRGMAGCRPPHRRAAGRRAPHRRVAAAGCRDPHRRAAGRPAGRLYCCSCDFFLTLNLAVWDLCRCSCFASVW
[ 8482, 29024, 29166, 70925, 87767, 87768, 88008 ]
The following text describes a protein: Function: Metallothioneins have a high content of cysteine residues that bind various heavy metals.
0
MDTESQYSGYSYKSGHSRSSRKHRDRRDRHRSKSRDGSRGDKSVTIQAPGEPLLDNESTRGDERDDNWGETTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDCSRHLGVAAGAILALLSFLTPLAFLLLPPLLWREELEPCGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFVLRALLMVLVFLLVISYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNST...
[ 6964, 7039, 7086, 7090, 7669, 7670, 8727, 9561, 10365, 11524, 11614, 12507, 12568, 13137, 13408, 13521, 13763, 13812, 13813, 14049, 15080, 15089, 15969, 15971, 16172, 17237, 17238, 17279, 17306, 17308, 17577, 17578, 17579, 17868, 19710, 19711, ...
The following text describes a protein: Function: Involved in the control of early morphogenesis and patterning of both axial midline structures and the development of neural plate. Plays a role in the regulation of planar cell polarity, particularly in the orientation of stereociliary bundles in the cochlea. Required ...
0
MGCCGCSRGCGSGCGGCGSSCGGCGSGCGGCGSGRGGCGSGCGGCSSSCGGCGSRCYVPVCCCKPVCSWVPACSCTSCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGCSQSSCCKPCCCSSGCGSSCCQSSCCKPCCCQSSCCVPVCCQSSCCKPCCCQSNCCVPVCCQCKI
[ 25040, 25075, 87692, 87976, 88008, 88009 ]
The following text describes a protein: Function: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated protein (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cr...
0
MSVSLLQPYFFMSKTKSYAQILIGSRLFLTAMAIHLSLRVAPPDLQQGGNSRISYVHVPAARMSIVIYIATAINSSLFPLTKHPLFLRSSGTGTEIGAFSTLFTLVTGGFRGRPMWGTFRVWDARLTSVFILFLIYLGALRFQKLPVEPAPISIRAGPIDIPIIKSPVNWWNTSHQPGSISRSGTSIHVPMPIPILSNFANFPFSTRILFVLETRLPIPSFPESPLTEEIEAREGIPLKT
[ 10765, 24979, 25079, 25709, 29895, 30838, 38044, 38849, 71286, 87362, 87760, 87785, 88159, 88161 ]
The following text describes a protein: Function: May be involved in the export of heme to the mitochondrion for the biogenesis of c-type cytochromes. Subcellular Localization: Membrane; Multi-pass membrane protein. Mitochondrion membrane.
0
MLLDEDPATLIRHTIGNFNIVPDKSAVARINESLSTLQQARDLRIREAESALKKLSRNLNTLNNNHLETVSAHSPTAHASEIATLDTQKFRIAKAASDLEIESERLSSQLADLQARLQELEQQGMEGGENVKRGQVDDEISLKLKVYRGLGIDIERDRESGEYSKAIIRNGKKGDVHVVNMDNKFSKFFYANYFWQTL
[ 8603, 16787, 24917, 25028, 25618, 47070, 65590, 87272, 87273, 87284, 87306, 87326, 87695, 87790, 87857, 88008 ]
The following text describes a protein: Function: Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. Subcellular Localization: Cytoplasm, cytoskeleton, microtubule organizing center. Nucleus. Chromosome, centromere, ki...
0
MDPNCSCPTGGSCSCAGSCTCKACRCTSCKKSCCSCCPAGCARCAQGCICKGASDKCSCCA
[ 8486, 9789, 15413, 18797, 18801, 18813, 24917, 24978, 29166, 32536, 35957, 50723, 50873, 55353, 87115, 87767, 87768, 87914, 88008 ]
The following text describes a protein: Function: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. Domain: Class I metallothioneins contain 2 metal-binding domains: four divalent ions are ch...
0
MMSSNLIMELSTMIPTHSEMLQNHSDQPSGNSTSHNSTNDAFDEFVRCLTLFTCICGVIGNGIVLWLLSFHIKRTPFSFYVLSLAASDFTYLFLEVIWVINYLLYRPMFQNIVNLLTNMGLHVTFTVGLGLLASISSQRCLSILFPIWYRNHHPKRGPMVVCGILWLMSLLLNPPKVYYCVVRMEELPPSGCDLMSKLSGTLMLSMLILMTLSSLILFIRVLWSAKRYKPKKLVILILLTVSVFLLCAVPHGINHSVFNWRAMYNHTFHEISYFLSCVNSSANPLIYFFIGSLKHQRLKEPLRVVLQRALRDDSDLTEDR...
[ 8678, 25079, 28715, 36171, 50338, 57581, 87276, 87484, 87522, 87760, 88006, 88008, 88152, 88159, 88161 ]
The following text describes a protein: Function: Orphan receptor. May bind to a neuropeptide and may regulate nociceptor function and/or development, including the sensation or modulation of pain. Subcellular Localization: Cell membrane; Multi-pass membrane protein.
0
MRIFVLEDDFSQQTRIETTIEKLLKEHHITLSSFEVFGKPDQLLAEVHEKGAHQLFFLDIEIRNEEMKGLEVARKIREQDPYALIVFVTTHSEFMPLSFRYQVSALDYIDKALSAEEFESRIETALLYANSQDSKSLAEDCFYFKSKFAQFQYPFKEVYYLETSPRPHRVILYTKTDRLEFTASLEEVFKQEPRLLQCHRSFLINPANVVHLDKKEKLLFFPNGGSCLIARYKVREVSEAINNLH
[ 8101, 25040, 25809, 27655, 27731, 37430, 42319, 45288, 72939, 87123, 87367, 87914, 88008, 88174 ]
The following text describes a protein: Function: Required for high-level post-exponential phase expression of a series of secreted proteins.
0
MFAAIASGNPLQLSVEVPNSNGLQHTIVLSRTKPKLYSHITLFILPNVTFPQDYIATVYFKLSPQEEFKLFGYLSSEKPSAIFKVQIPSSKKDAGDTSDGLGEIDMDVDDGSGAADPFTDTNGSSSNNISELIIGISIEPREQGMMKLEEWKASMNAEAQKNNSLILSRPNLGIIRNITTAGQLAQVYPSLTQELAAKIVQHAYNYLSGFLDAQGNVPIKRFDTWWDKFRNRLANDGTFLDEVTKN
[ 7892, 8286, 9126, 24917, 24978, 25040, 34098, 43162, 60231, 74231, 87367, 87728, 87731, 87857, 87909, 87911, 88008 ]
The following text describes a protein: Function: Involved in phospholipid biosynthesis. Miscellaneous: MISCELLANEOUS: Present with 1910 molecules/cell in log phase SD medium. Subcellular Localization: Cytoplasm. Nucleus.
0
MFGNLKKKLSSAIQEGLVISENLQQQYRQRVSSGNSGSSQASGITTPISPLGLNESLSSSRSSSLSLSAPFQLTDGVPSHLNVAAGCSLLAKYEDDWQQIHGANEKNAEKAAQIANQISGIQDQASHQHRIMSELNSSLAGIPTLIAQLQNSSQVLNSLEEMGKQLEIELEKLEDLREECELQEFILEQQFQLSRHKQKKLNELEQYRQQIAQKHQSKIKDQEQTLLKLQRERQAVFDDAFREDMEEYKQRGQLTKIQTTSNKLALEEVVLEANEVETKDALEQFLNG
[ 8976, 8978, 9013, 9069, 9075, 13794, 15441, 15937, 15990, 16503, 17073, 21254, 25136, 25578, 27007, 42352, 87326, 88008 ]
The following text describes a protein: Function: Component of the biogenesis of lysosome-related organelles complex-1 (BLOC-1) involved in pigment granule biogenesis and membrane trafficking in synapses. In response to high synaptic activity at neuromuscular junctions, stabilizes Pldn protein levels and, together with...
0
MLGDTALKLVHDSRRTAALDLLPAYQEELVRGVCREIRQLDASINKTQDEPGYDPQDRVAHCNLLVQHLAMRRDKRCLLAYQFTRARRMNEAAWKQTEEPNLNGNEQEYMKAYEDLIVDIKGPYTDIDLTGSLEPPNDVFIDVRVLQSVGEVQTEYGVFNLEKDSQFFVRRSDVQTLLLQGYLKEI
[ 22297, 22300, 24803, 40415, 53214, 63993, 87381, 87857, 88008 ]
The following text describes a protein: Function: The GINS complex plays an essential role in the initiation of DNA replication. Subcellular Localization: Nucleus.
0
MDTAERAYEKFQNQMIAFDNLKIEMNELAVDLDQQLSDKQSLILQQEQDHKQKVNDLTNQEYKLKLQAKSLKEKENATRDKLNLAMRSLEQQKSKVEDLVKKKQSLVDTKQDLESQIKQLETAIDQGTRELNKSNDNMSLQMNKNLVELNKYEIYTGLKIEVQSNELMCFKFFNLDPNDYDREFAITLNIGGSTYSIENTSPKLSDETVEQIQGKLNQGRQLSKFLKEVRTLFKDFVQY
[ 8603, 16787, 24917, 25618, 47072, 71364, 87272, 87273, 87284, 87306, 87326, 87695, 87790, 87857, 88008 ]
The following text describes a protein: Function: Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. Subcellular Localization: Nucleus. Chromosome, centromere, kinetochore. Note=Associated with kinetochores.
0
MSEGDAYEDFMMSEDEEMHYAEMEEDSDEMGVYEEETSQGAEEEVPLDPSSSIVEGRYYRAKGLKENSKFREAIEALEGVATSSEPLWAFRALKQIAKCWNFKGAQASEGYQDGVRTALVRLLEHGLRWRQKLGAAYVERSLISTLRMLVPANSQNFVFDEAHEICLPTIEFHLRLLDAVAPLPGDFKDLCTLHMQLRLENLIWRERLRGADCTAILSEAPAPQLTAETLLLLLQCHICRFLRLCQPPAQQFAELVSELQDRAERSLALAQQPHAMVLLAFAQCMRGMQQQPQPHSALRTHFSACLQGLEEIGSNSSFFR...
[ 6713, 24978, 25142, 36533, 76526, 87367, 87857, 88008, 88062 ]
The following text describes a protein: Function: Component of the COP9 signalosome (CSN) complex that acts as an regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunit of SCF-type E3 ubiquitin-protein ligase complexes. The CSN complex is involved in the regulation of ...
0
MQPQIILITGASSGFGKITAQMLSEQGHIVYGTSRKPSENIGKVRMLVVDVTNSISVRQAVEQIISEQGRMDVLINNAGMGIGGALELATEEEVSMQMNTNFFGVVNMCKAVLPYMRKARRGKIINISSIGGVMGIPYQGFYSASKFAVEGYSEALALEVHPFHIKVCLVQPGDFNTGFTDNRNISELTGQNEDYADSFLRSLKIIEKEERNGCHPRKLGAAICKIVARKNPPFRTKVGPLVQVLFAKSKSWLPDNMMQYALRIFYAIR
[ 7, 8333, 11615, 25325, 32918, 34296, 37894, 52988, 64058, 77563, 87731, 87823, 87855, 87873, 88008, 88070 ]
The following text describes a protein: Function: Catalyzes the reduction of 3'-oxosphinganine (3-ketodihydrosphingosine/KDS) to sphinganine (dihydrosphingosine/DHS), the second step of de novo sphingolipid biosynthesis.
0
MKNLSETEAEVTMQENVVHESLPQIPVATSVSCCFVLAVLYVGSLYIWSTKHNRDHPTTVKRRFASVSMVMLAAPFFVYFFSSPELLSRVPFPKLLGLRLEGLWQAVVIPYSLTVLLFLGPIFVNMQNESVRSYFDLDYWRGSFGSIIWVRNHVIAPLSEEFVFRACMMPLILQSFSPLVAVFITPLFFGVAHLHHIAERLSLGVELSTALLIGLFQFIYTTLFGFYSAFLFARTGHVMAPILVHAFCNHMGLPDLQDLWQQDLWRRVVAIILYLAGFVGWMFLVPLATDPSIYDNTLYWNA
[ 4840, 18999, 25014, 28225, 38927, 67032, 87432, 87601, 87760, 87965, 88008, 88159, 88161 ]
The following text describes a protein: Function: Protease involved in the processing of a variety of prenylated proteins containing the C-terminal CAAX motif, where C is a cysteine modified with an isoprenoid lipid, A is an aliphatic amino acid and X is any C-terminal amino acid. Proteolytically removes the C-terminal...
0
MLSRSRIALSASYALLNASKRSVGKIVQPSIVILNNRCISQSPRLAKENAVQTTSNRTLKELIEEKTGTSGPYVLGGGILAYLLSKEMLVLHTETLIALSIFGVSYGIIRKVGKPTAEFLDQQGDEILDTLNEGRNMQMERLQEAIEAEKGIERMFDSRNEIFEVMKENNAMKLELEYRKRQQHVYEEVKKRLDYQVEVEQTKRRQEKEHIVGWLEQEVVKSISAQQEKDFLSQCFVDLKAISSSNRL
[ 10591, 24983, 26421, 29777, 43324, 47569, 87238, 87598, 87676, 87760, 87785, 87786, 88008, 88162 ]
The following text describes a protein: Function: Subunit b, of the mitochondrial membrane ATP synthase complex (F(1)F(0) ATP synthase or Complex V) that produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. ATP syntha...
0
MFKDHQSLIPNEIRDLLDLSSVGKSSPGALLTGCSAGGLSTILRCDDFKSLFPLSTKVKCMRDAGFFLDTVDISGGRTLRRMYSGVVNTQCFFPQNIISQVMTPLYILNSAFDSWQIGNSLAPPSADSSGSWHDCSFMFRCNAAQKKVLEGFRISMLNALETFLTTRKNGVLITSGGKQAPFLQRLDQRGLLDLETDWMGLIELTCLPPAGIVATQRAPWLIWSLWTAPKDWQNAQCQDEPKKPSQRKIEDVPHYDTVLQTDAAWTETTGTAGLGWAIKTARETQRFSSSTTFVISPLMAESLAMREAIKKSKELGIRRL...
[ 3922, 18986, 24878, 25223, 33957, 40072, 87280, 87281, 87601, 88008, 88038 ]
The following text describes a protein: Function: Hydrolyzes acetyl esters in homogalacturonan regions of pectin. In type I primary cell wall, galacturonic acid residues of pectin can be acetylated at the O-2 and O-3 positions. Decreasing the degree of acetylation of pectin gels in vitro alters their physical propertie...
0
MWEQRRQKVVFSLTILVRYRLKQSMAKKISKNSRAARQSDALEPEVKDLSELPRAEKTDLTNILIRTAAKNEALLEAKISKKANKSKRGKKLNKKALEDKLANSISSMDRDRLVKALNFTNRLDGKIAKSISRAKYIQNTRKAGWDSTNETIKKELAFLNGGLSVQAKSASEGNAEKEDEEIPEVFDSLAEDNTVQKTPTNRFGVLPDDVEE
[ 6658, 24917, 24974, 24978, 25526, 54707, 78925, 87103, 87367, 87857, 87914, 88008, 88023, 88162 ]
The following text describes a protein: Function: Pre-ribosomal factor involved in 60S ribosomal protein subunit export from the nucleus. Miscellaneous: MISCELLANEOUS: Present with 2840 molecules/cell in log phase SD medium. Subcellular Localization: Nucleus, nucleolus. Nucleus. Cytoplasm. Note=Shuttles between the nuc...
0
MTDNAIPGPLDPEELQIQYAKSFLLQTDNSGLSLYEHLSALLSRILSERPPNALEVFESLSAELHWSRLKQGSDVLRAPREESHTCRKAEVQRALFSRGDGEGEESEAEGEMTESPLPNLLDLAHLLQQGGVNLGRDEAVRISLALKRLTDTHPLQVCHFWGKILGSGGSYLVAEVQFREGEDDEAEEGGEEEEKGEVEDDVEEEENEEAEDLPPKSTYRPPPVIPKEENGTGANKHVYYVCSEAGAEWVRLPPVTPAQISAARKIRHLFTGNLDAPVITYPPFPGTEINLLRAQIARISAGTHVSPLGYYQFGEEEGEE...
[ 17404, 17421, 24836, 25668, 41726, 87278, 87311, 87367, 87371, 87468, 88008 ]
The following text describes a protein: Function: Functions as part of radial spoke complexes in the axoneme of sperm flagella that play an important part in motility. The triple radial spokes (RS1, RS2 and RS3) are required to modulate beating of the sperm flagellum. Subcellular Localization: Cytoplasm, cytoskeleton, ...
0
MESGDSGLAAQGFLGWGADEEVAQELETEEESEGEGEETAAESEEEPDARLSDEDEEGKTKQECIVSDPSFSMVAVQREDSGITWETNSSRSSTPWASGESQTSGICSLEGSALTSPPGSVSFIMDEVKRTRKRTQKSKRGSPSLRRKGSKKRNSLESQDVLTNQEDGPSISESPVLNIENEKSSIGTYDKTRRKKTASNTPPITGAIYKEHKPLVLKPVYIGTVQYKIKMFNSVKEELIPLQFYGTLPKGYVIKEIHYRRGKDSSISLEPDLSNGGSNIVPQRKLAQSPEEDKVRELAPPWRGALSKGSRTSLFSHEEQ...
[ 10293, 18661, 24917, 25353, 25645, 26199, 26465, 28676, 32073, 37495, 39106, 39177, 47128, 47529, 63892, 69826, 76272, 87326, 87367, 87857, 87914, 88008, 88009, 88035 ]
The following text describes a protein: Function: May serve as an anchoring protein that mediates the subcellular compartmentation of protein kinase A (PKA) via binding to PRKAR2A. May attenuate calcineurin ability to induce slow-fiber gene program in muscle and may negatively modulate skeletal muscle regeneration. Pla...
0
MNILSAIIVFENLHEVKRLFHWGPIIALTVIGVCSSMAILDSIIWYWPLDTTGGSINFIMLINWTVLILYNYFNAMFVGPGYIPLEWKPEKQQDIMYLQFCRLCQGYKAPRSHHCRKCNRCVMKMDHHCPWINNCCGHLNHAYFTSFLLLAPLGCIHAALIFIMTMYTQLYDRISFGWSSVKIDMSAARHIHHPIMPFSIAAFAATLFALGLALGTTIAVGMLFFIQMKVILRNRTSIEAWIEEKAKDRIQYYQTGEDFIFPYDLGSRWENFKQVFTWSGAPMGDGIEWPVHEKCDQYTLTIEQLKQKHDKRQRSVEYRV...
[ 2459, 2570, 8290, 25008, 25014, 25018, 30754, 35392, 37269, 87125, 87432, 87735, 87760, 87882, 88008, 88031, 88153, 88159, 88161 ]
The following text describes a protein: Function: Endoplasmic reticulum palmitoyl acyltransferase that probably catalyzes the addition of palmitate onto various protein substrates and is involved in a variety of cellular processes (By similarity). Could also function as a stearoyltransferase (By similarity). Subcellula...
0
MSRENNCTTADLAWGIPSITQAWGLWALFGVVTMLLLISLAALLSQWTRGRRRTQEEQGPPSGRSVEEVPLYGNLHYLQTGRLSEESRSEEQDPSSGGLARGAEEATCYTSLQLRPAQGRIPSSGTPIKYCEVVLDSEPKPQASGPEPELYASVCAQTRRARASFPDQAYANSQPAPS
[ 7262, 8663, 14453, 16534, 25079, 30810, 61701, 87126, 87276, 87413, 87522, 87616, 87760, 87914, 88008, 88061, 88159, 88161 ]
The following text describes a protein: Function: Negatively regulates T-cell antigen receptor (TCR)-mediated signaling. Involved in positive selection of T-cells. Subcellular Localization: Cell membrane; Single-pass type III membrane protein.
0
MSPLPLRDPSHQANAGPRLVEPSCGPGVSLSNRTLCHPSWPMYDNWGRSPTTSERPEEEQVVSKDTGVPVRNYEDVFLLDPLLPCGQRVPLILTKPPQQAMDSRKLLLPPPIMSPSVHPSSSQACSSTWLSEAEMIALAGLLQMSQGEQTPNCVASSLPSTSCPDPVSVSEDPGPSGDQSCSGTDT
[ 15387, 24917, 24978, 59323, 87103, 87367, 87857, 88008, 88010, 88148, 88150 ]
The following text describes a protein: Function: Involved in the transcriptional repression mediated by the mSIN3A but not the N-CoR corepressor complex. Subcellular Localization: Nucleus. Cytoplasm. Note=Shuttles between the nucleus and the cytoplasm.
0
MKIGSGEKLLFIGDSITDCGRARPEGEGSFGALGTGYVAYVVGLLQAVYPELGIRVVNKGISGNTVRDLKARWEEDVIAQKPDWVSIMIGINDVWRQYDLPFMKEKHVYLDEYEATLRSLVLETKPLVKGIILMTPFYIEGNEQDPMRRTMDQYGRVVKQIAEETNSLFVDTQAAFNEVLKTLYPAALAWDRVHPSVAGHMILARAFLREIGFEWVRSR
[ 3987, 15166, 24978, 28482, 32497, 47565, 64260, 77185, 87103, 87258, 87367, 87601, 87937, 88048 ]
The following text describes a protein: Function: Acetylxylan esterase involved in the degradation of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. Cleaves acetyl side groups from the xylose backbone ...
0
MINQRLFEIDEWKIKTNTFNKEHTRLLESLTSLANGYMGVRGNFEEGYSGDSHQGTYIAGVWFPDKTRVGWWKNGYPEYFGKVINAMNFMGIGLYVDGEKIDLHQNPIELFEVELNMKEGILRRSAVVRIQDKTVRIRSERFLSLAVKELCAIHYEAECLTGDAVITLVPYLDGNVANEDSNYQEQFWQEEAKGADSHSGHLAAKTIENPFGTPRFTVLAAMANETEGFVHESFKTTEMYVENRYSYQTKASLKKFVIVTTSRDFREEELLSKAKELLADVVENGYEDAKRRHTDRWKERWAKADIEIKGDEELQQGIRY...
[ 3052, 6647, 7854, 28423, 30908, 33300, 40287, 40288, 40289, 43533, 45294, 46278, 49976, 64735, 87258, 87525, 88008, 88153 ]
The following text describes a protein: Function: Catalyzes the phosphorolysis of maltose, leading to the formation of glucose and glucose 1-P.
0
MYGIFASFRRGSQLENITLHARDLSSKISPSIARILKDAKRTNNGRKHPKISTLQLARTKRKFIQQGKEWPQEPLPPLNLKPYRKGHKWEEAKAARKVTIAENMAKMPQMIAEYREQVRERREKYRNRKDAAKKDPNQPEYVQYLLAKGVRLADIAVKLGTQNKKAKI
[ 24917, 24979, 25047, 27616, 51151, 68002, 69741, 87272, 87326, 87785, 87857, 88008, 88020, 88022 ]
The following text describes a protein: Function: Acts as a negative regulator of G1 to S cell cycle phase progression by inhibiting cyclin-dependent kinases. Inhibitory effects are additive with GADD45 proteins but also occur in the absence of GADD45 proteins. Acts as a repressor of the orphan nuclear receptor NR4A1 b...
0
MIDLFAIVNKGGIVLWKKTNSLVNLKCLQVLFHEAFLSEQRTVNNTVTFDRYTMQYQEATQYSIVFVVVFQDLKCMAYSQSLLNSAHNIFLNLFKEKLEDRQVPNEAEVEKLFAPIFNRKSAQLENETDTKSLPVEANNDNSARKKNEYEMKKKGAQSKQTNAPKKGKKQLRKWDDQITEEEQAALNYSSQASSASQTVDNSQLSSIVGNNNKFQKTGSGDVIISDLEMDPNQTISNKSASSAFSLFSNLIGGKYLKEEDLSPILKQMQEHLTKKNVANSIALELCESVKASLINKKVGSFDTVKNTVNKAFRDRLTQIL...
[ 8292, 8490, 15025, 24917, 25010, 25014, 25040, 28025, 28801, 29034, 30398, 36688, 38873, 42078, 45293, 47559, 58239, 63994, 69095, 87432, 87491, 87760, 87855, 88006, 88008 ]
The following text describes a protein: Function: Component of the SRP (signal recognition particle) receptor (SR). Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system. GTP hydrolysis may enhance the fidelity ...
0
MNTRQLLSVGIDIGTTTTQVIFSRLELVNRAAVSQVPRYEFIKREISWQSPVFFTPVDKQGGLKEAELKTLILEQYHAAGIEPESVDSGAIIITGESAKTRNARPAVMALSQSLGDFVVASAGPHLESVIAGHGAGAQTLSEQRLCRVLNIDIGGGTANYALFDAGKISGTACLNVGGRLLETDSHGRVVYAHKPGQMIVDECFGAGTDARSLTGAQLVQVTRRMAELIVEVIDGTLSPLAQALMQTGLLPAGVTPEIITLSGGVGECYRHQPADPFCFADIGPLLATALHDHPRLREMNVQFPAQTVRATVIGAGAHTL...
[ 11607, 15621, 25655, 43883, 69819, 76351, 87203, 87285, 87411, 88008 ]
The following text describes a protein: Function: Reactivates suicidally inhibited ethanolamine ammonia-lyase (EAL), cyanocobalamin-inactivated EAL and O(2)-inactivated EAL; requires Mg(2+), ATP and adenosylcobalamin. Reactivation probably occurs by the ATP-dependent exchange of cobalamin. Subcellular Localization: Bac...
0
MKDSAILNQLKVVLPPHIMEIIYFRYNQIDTYLKPYNLPIKTDVLLLALFTLIFIIIISKLFGSSGNKTRSVGGRTSNDKKVKRGVNIAILGLSNAGKTALLLNLTNVDKKISTHTSITTNNGVYITENKKKLPIIDVPGNGKAKASLPKILSNSACIIYVIDGTTFIDNSTQEAQYLYDILTNESVYQKKIPVLVFNNKMDLDSTIDTEQVKNILERELDDLRRTRGATPIVLGQEEDKKDIYLGIEGTPFQFDHLPNDVQFSNGSASPSNGELKEIDDIKNFIQTTTL
[ 15025, 25010, 29034, 40315, 51630, 55834, 58239, 87432, 87491, 87760, 87855, 88006, 88008, 88159, 88161 ]
The following text describes a protein: Function: Component of the signal recognition particle (SRP) complex receptor (SR) (By similarity). Ensures, in conjunction with the SRP complex, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system (By similarity). May mediate the ...
0
METTARVHQPKAGSSSSRHRSSRARRSATPQRLEQLEQSEARGIDDVSSQQSPDQEMAMADGTSKNRTTAPSRTVRRPDTPEHSGASSTTTNASGSVTGMTVPDSGALSRVSQTPRSNSPAIVTTELVAEQAPPVASEEPAAGPPADKLQKGILGYMDRQLKVQSLSDSQKSPAQRSTRSSTRSSNLDKSPRRKRSKSESRRRRERKILAAGEMEVRQANETLMRYLKQCSDFNDASLSGDLEIPEPLEDRRVHRKTKSQRERKQHQPQQPDHRSGGRTHADDLMSYHGEIYNPFTPVVSPTTEAAATRIDKMYIQTASG...
[ 17404, 25325, 26048, 59561, 87278, 87311, 87312, 87760, 88008, 88159, 88161 ]
The following text describes a protein: Function: Component of the transition zone in primary cilia. Required for ciliogenesis. Subcellular Localization: Cell projection, cilium. Membrane; Multi-pass membrane protein.
0
MESDPPPTSPSRAQPGRSQLNATSSAAGNEDPQRQGPTPGDHATPPPGRAEPEKNETVKDVTELSLEELLEKAKAGDPKAQTEAGKYYLKLAEDADEELNNSNAIDWLILAAKQGRREAVKLLRRCLADRRGITTENEQEVKKLSSETDLERAVRKAALVMYWKLNPKKKKQVAVSELLENVGQVNEQDGEKQPGPIPKSIQKQRRMLERLVSSEAKSYFALDDFVEITKKYAKGIIPSQLFVQDDDDDELAGKTPEDLPLRLKVVKFPLHAIMEIKEYLIEMASKAGMHWLSTIVPTHHINALLFFFVISNLTVEFFAF...
[ 6673, 7018, 7641, 8554, 8966, 8970, 10779, 11875, 12027, 12340, 13808, 14280, 14681, 15414, 16511, 17053, 17185, 21982, 22746, 22949, 24412, 25014, 25473, 25480, 31139, 33735, 35433, 46079, 57555, 57556, 71602, 71651, 71653, 71654, 87115, 87369, ...
The following text describes a protein: Function: Participates in the regulation of cellular Ca(2+) homeostasis, at least partly, by modulating the filling state of the endoplasmic reticulum Ca(2+) store. Negatively regulates the ER stress response and positively regulates the stability of V-ATPase subunits ATP6V1A and...
0
MTDLNSESFSALNFWKSVEKKNISTNFQGTKVVAPSKKINSFPLLAPPAPPPPPTEQEINIGSGNSTFISSNNNNSNNNNNNNSNNNNNNNLNNSNNNNNNLNSNNNNNNNNNNNNNNGNNNNNSNFLTRQDSSTQKEWDEQNVTEAFGFWKQKAVQLQKETERYNARRNARQTIDLTNILRKSTSSDLLIKPPVESPPLTPVGQDDEGEQQQQQQQQKQSSPSTPSNDTDTETTAAAVTTTTTTTTTTTTSTTTTTTETVLQANQLEIKYGGETIAVVDDSGTTPRDYRRSRSISCEIIPKINGVITTSPQRVTTTTTT...
[ 8522, 11826, 12353, 15732, 17297, 17957, 23541, 24978, 25114, 25444, 25482, 25608, 26653, 27370, 27873, 28810, 29319, 31103, 33717, 36104, 36477, 37516, 43538, 55346, 64687, 87118, 87278, 87287, 87367, 87371, 87535, 87914 ]
The following text describes a protein: Function: GpaB-activated, rapA-specific guanine nucleotide exchange factor, involved in the regulation of the balance between Ras and Rap signaling at the leading edge of chemotaxing cells. Spatially localized activation of Rap and Ras induces F-actin polymerization at the leadin...
0
MSFLCGSASTSNKPIERKIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFVDSKHITLSLWDTAGQEEFDRLRSLSYSDTQCIMLCFSIDSRDSLENVQNKWVGEITDHCEGVKLVLVALKCDLRNNENESNAITPNNIQQDNSVSNDNGNNINSTSNGKNLISYEEGLAMAKKIGALRYLECSAKLNKGVNEAFTEAARVALTAGPVATEVKSDSGSSCTIM
[ 8572, 8663, 8725, 11869, 12568, 15408, 19886, 25040, 25079, 25110, 28025, 29034, 30811, 37443, 38866, 40315, 58239, 87276, 87491, 87735, 87760, 87776, 87855, 87951, 88008 ]
The following text describes a protein: Function: Plays an important role in cell growth. Required to keep the uninucleated state. Modulates morphogenesis during bud growth via directing organization of the actin cytoskeleton and the position of the secretory machinery for exocytosis. Miscellaneous: MISCELLANEOUS: Pres...
0
MRKSLITLGLASVIGTSSFLIPFTSKTASAETLDEKKQKIESKQSEVASSIEAKEKELTELQENQSKIEKELKDINDKALDTSNKIEDKKEENDKTKEEIKKLKKEIKETEARIEKRNEILKKRVRSLQESGGSQGYIDVLLGSTSFGDFISRATAVSSIVDADKDLIKQQEQDKAKLEDSEADLNDKLKEVQAALAKLETMQKDLDKQLNEKDKLFDEAKASQKKTAKAISELKSEASELANQKANTEAEQARIKKEQEAAAALIKKQEEAQKASDETQTDDSQTATTESSKASSSDDSSDNSSDNSSNGSSNSSSNGS...
[ 4484, 6692, 8200, 18986, 24878, 28216, 29145, 36001, 66234, 76856, 87103, 87280, 87281, 87601, 87965, 88008, 88038, 88058, 88134 ]
The following text describes a protein: Function: The C-terminal part of CwlO shows a cell wall hydrolytic DL-endopeptidase activity. Miscellaneous: MISCELLANEOUS: The N-terminal part of CwlO was shown to have no cell wall-binding activity. Subcellular Localization: Secreted. Secreted, cell wall.
0
MSLLHEKQVRVLKLFERLSVAASGEKIPADQIDARLSTVGELPNSAFFSCFLPAHLEEAKRLIEIFYSAKDFDDFVLLAEQARTFVNSTLFAFAAEVAILHRADSRGIIVPPIQEIFADRFVPADTLIRAFSVATTKPAGDESDVIIDVQETGNILDPEYKLAYYREDIGVNAHHWHWHVVYPSVYDSKFFGKKKDRTGELFYYMHQQMCARYDCERLSNGLTRMVPFHNFEEPLEGYAAHLTHIASGRHYAPRPDGLAMTDLRLVDVQDMQRWTERILEAIHLGKVIDSEGNDIILDEETGADILGSLIESNLESKNRQ...
[ 24878, 28962, 29024, 30200, 31111, 36687, 37787, 40296, 40297, 43528, 47534, 48276, 64437, 64737, 87346, 87413, 87522, 87767, 87874, 88038, 88162 ]
The following text describes a protein: Function: Hemocyanins are copper-containing oxygen carriers occurring freely dissolved in the hemolymph of many mollusks and arthropods. Subcellular Localization: Secreted, extracellular space.
0
MGDSANTASVRFPLSADAAAEALAVAGQQRGAAHLLSNEDDVDEDDVYEESEERYNSDDDAHGGERSLPAKTAEAAASVFMKGTPRSFGPVAGAGGDLGSGAEAKGAGGSAAASLNAQRSALIAANLSRQLFKAKMPDIAASTKYQDELEEEDLDQLSAVDRDFVMNTKDLFDDVDAELLGEDFVPHEHVVGIIASEATGGEASPDEIDDNLVDYKDLEAEINADLADYIDAHHQEFNNAICDFSEMVLAVSGSDDTLAEFKKELADAIVSLESHAGELKVLRLRAAKSLFMADALEHIQEVVLAEAEVKGLLQNRHYLA...
[ 8290, 8491, 8496, 8504, 10368, 19972, 24727, 24978, 42048, 66989, 87448, 87974, 88008, 88162 ]
The following text describes a protein: Function: Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane.
0
MALRFSVLRLASYLGRKKDLYQILEVESSATHDEIKRAFVRLTARLHPDTRGVDKESERLQWSNRSLTEQFMEVKEAYDILRKPEKRKEYDEERRLAQGLDGHLVEATSARFEKNTVINLQRDRNEMYTGPGKKRDDSASGHFRNPEEEYEKERQKNRSLYLIGALFLSIVLTNIGYVHYLRSSDNRKVL
[ 13808, 25008, 25325, 33731, 33820, 37291, 64599, 77600, 87285, 87760, 88008, 88159, 88161 ]
The following text describes a protein: Function: Co-chaperone for Hsp70 protein HSPA5/BiP that acts as a key repressor of the ERN1/IRE1-mediated unfolded protein response (UPR). J domain-containing co-chaperones stimulate the ATPase activity of Hsp70 proteins and are required for efficient substrate recognition by Hsp...
0
MFTYVSKFFTNPDRNREDILESLDRENSFLDQKLMEEKMDQQLKANPNEINGVLSNKIAELTHGLSEMDVSKESSCTARKGVITSLDGDRGVIDKDVLFETKVAEDIILDLHVGCVVEYLTFTTGEAMRVVKVKSILEHSWEDTSQKEIEKAVDNLKNEKPTFFNTETRSVLGLISQRLASSIDVETEYGQLTVELDNIEMNFIPTNGDRVRLECNIQLDDGFVDKQGEILEVTKLFPTRIQEGEKCIVERVYVHMVVLGPETYILKTDLPTGTDLHLGDIVLADLIECQYSKFTRRAIKITPLEKNFGATKLTQQSSMG...
[ 5174, 6682, 6779, 8752, 8776, 8978, 11891, 13236, 15859, 16123, 18675, 21043, 21052, 23982, 24978, 25040, 25494, 25495, 25625, 25776, 26197, 26207, 26663, 27925, 27926, 29033, 30398, 31341, 31706, 58239, 68695, 68697, 73159, 74878, 74879, 87110, ...
The following text describes a protein: Function: Probable RNA helicase required for axial polarization of the oocyte during early and mid oogenesis. Plays a central role in RNA interference (RNAi) process, a process that mediates mRNA destruction of translational repression. Required for the assembly of the RISC compl...
0
MAFPRSSSISFFTFLLFSVLINTAISSRVSSFIKLPTSVDESVSSSLESYCASWRLAVETDNAGKWKVVPSQCVSSLETYYDKGQFDKDYSVVAGYAYAYAKTITLKGDGKDAWVFDIDETLLSNLEYYKAHGYGSEPYNSLAFNEWVLQGTAPGFAASLKLFNRLKKLGFALILLTGRDEVQRSVTEQNLLDAGYSGWEYLLLRGHQDQGKAAAQYKSEQRSRMVKEGYRLHGNTGDQWSDLQGFSVADRSFKVPNPMYYIA
[ 28075, 32459, 40575, 44447, 48075, 55054, 64168, 87522, 88008, 88058, 88084 ]
The following text describes a protein: Function: May function as somatic storage protein during early seedling development.
0
MAFLYENEGTTRTLLHQVLEMHPLSSPISTNNRSRSCTESLFASSDTTLRKRKKTAPVQPKDTGGTDQHFVEHYDLLEKGTPRILLKKILQTASEDSVLVPVLMNSQEPVPVELQEESKWNSLELQLPEPEPSASLAPELLIHSRRKRCLRVSEFEQEVDQGLAVSSDLTGEKRASANKSSMSRSFNLTLATVIPPESVERPGLARRPQIRKKVDMEAFEHGLKDIPLTLLSDRCSNHSTTPVDGARSFQSSPYSLRFRKSLTKDQQPRATTYQANQRKKGPRRAIKSWPKSPLQNQPPSANSMSIRRQARPWTGRPSQN...
[ 6695, 8603, 16787, 16815, 24783, 24917, 27904, 32577, 43635, 58861, 61138, 63277, 87272, 87273, 87284, 87306, 87384, 87695, 87790, 87857, 88008 ]
The following text describes a protein: Function: Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be invol...
0
MATAPAPADAKAEAAKMDLLEDDDEFEEFEIDQEWDDKEEGNEAVQQWEDDWDDDDVNDDFSLQLRKELEGASAQKS
[ 6796, 8135, 14543, 24780, 24917, 25160, 42626, 87857, 87967, 88008 ]
The following text describes a protein: Function: Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. Subcellular Localization: Nucleus.
0
MSTDQRDRLLEGVGWKARGDRIPEFPNPRPFFPRLKHSIKLIPLFVRVALHTFVEWWNGREAFIDIFNVFRHFTYTGVPLGGIGSGSIGTDFRGGFNRFSIIPGIKEQTETQKCNQFIASVHSKKTFELIYQSILSCAEFPATVLPKWDSTIPAEDVRYRGLFPRAWQEFRLGTSGITVVVEHLSPVIPEDYSDSSLPLANFDFHVFNDSPEEVEVSITMSFRNGTGNKKWNDESLCQSHKVQKDTMVVRTLSHTVKGMPVTYAIGTEEKNGAKVTTCLFDPNGTGGRLWSDLEAYGHLSSYDHLPPKPKELGIAVCSSF...
[ 4386, 7854, 8346, 25325, 28264, 29225, 41700, 43533, 46278, 48169, 56102, 78215, 87523, 87601, 87731, 87760, 88008 ]
The following text describes a protein: Function: Non-lysosomal glucosylceramidase that catalyzes the hydrolysis of glucosylceramide (GlcCer) to free glucose and ceramide.
0
MWRLLLALLLVSSVCCESELFRDDLRTPETMAYINGLMQRRHQMQQEAQQHIQAIPPAVPLQSPGLVNGLGNQNDPALNRISGTSVKPSNLPAAYSNGYVDLATSDRIANSVLNFANILGQHLANGKTQIYSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTSRLHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASDIPQTTRMILANALYFKAFWETDFIESATRPDNFYPNGEGT...
[ 7331, 9350, 13131, 14219, 15373, 24907, 28679, 36120, 55539, 63958, 69165, 69169, 87402, 87522, 87616, 87758, 87966, 88008, 88038, 88051, 88058 ]
The following text describes a protein: Function: Serine protease inhibitor which is required for pupal viability and plays an essential role in regulating the melanization reaction. Inhibits spontaneous melanization and appears to be involved in the melanization immune response to physical wounding in larvae and adult...
0
MSPCGRARRHTSRGAMAVLAWKFPRTRLPVGASALCVVVLCWLYVFPVYRLPDEKEIVQGVLQQGTAWRRNRTAAGIFRKQMEDCCDPAHLFAMTKMNAPMGKSLWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEADFVMRCNLPPLSSEYTKDVGSKSHLVTANPSIIRQRFQNLLWSRKTFVDHMKVYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSG...
[ 3128, 8188, 8192, 8332, 9280, 24724, 27950, 37336, 46189, 66060, 76598, 87413, 87522, 87525, 87528, 87728, 87731, 87760, 88008, 88061, 88070, 88153, 88159, 88161 ]
The following text describes a protein: Function: Catalyzes the addition of sialic acid in alpha 2,8-linkage to the sialic acid moiety of the ganglioside GM3 to form ganglioside GD3; gangliosides are a subfamily of complex glycosphingolipds that contain one or more residues of sialic acid (By similarity). Can catalyze ...
0
MQCSWKAVILLALVSIAIQYTAIRTFTAKPFHICPVPNPLNCGLGQDVESFDRMCDEYPYFNYNSSRKTHILILATTRSGSSFVGQLFNQHSDVFYLFEPLYHVQTTLIPHLSPSRYAVERRVMLGASRDLLRSLYNCDLYFLESYIKPQPANHTTDKLFRRGASKALCSMPVCDAFSPNDGNIEEGDCVRKCASLNLTLATESCRERRHVAIKTVRIPEVNDLKALIEDPRLNLKVIQLVRDPRGILSSRIETFRDTYRLWRIWRATGRKPYNLDLTQLTTVCDDFLNSVSTGLSRPPWLRGRYMLVRYEDLARNPLQK...
[ 3861, 7854, 7905, 14165, 24724, 27793, 32392, 36659, 49474, 58239, 76789, 87258, 87522, 87528, 87760, 88008, 88061, 88153, 88159, 88161 ]
The following text describes a protein: Function: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of galactose (Gal) residues of keratan. Subcellular Localization: Golgi apparatus membrane; Single-pass type II membrane protein.
0
MQYQHPSSSALGLSVPLFAPTPLQHPTPFYIDDILGRNSASNGTPALPTPTLPSPNSSFTSLVATYRTPIYEPTPIHPAFTHPGAALAASYGASTYASPLYPFSRPVSDYTHALIRHDSLGKPLLWSPFIQRPLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQGNKKDETESLENICEESQERCLSAEQKSRESSLDDPTSSPTSQGNLDSEVSDDSDQEVDIEGDKGYYNCAH
[ 6673, 6911, 7053, 8103, 8912, 9561, 10615, 11620, 11630, 13215, 15387, 24917, 27733, 27735, 32185, 37071, 43624, 50806, 52772, 76654, 87384, 87402, 87566, 87857, 88008, 88010, 88148, 88150, 88256 ]
The following text describes a protein: Function: Recognizes the DNA sequence 5'-ATTAA-3'. Transcriptional repressor. Regulates the differentiation of both endothelial and blood cells (By similarity). Probably plays a role in the proliferation of vascular endothelial cells during blood vessel development. Establishes a...
0
MFAMYNSYNEAEKTVFVGNLDSSVREEILFELFLQAGPLTKVTIAKDKDGRQRSYGFVCYKHREAVPYAIALLNGICLYGRPIKLQYRLGSSHNAEAHAVFPVLENGPGKPSQESYRTVCCQKASVFPSSAVSTCLSQENLCWQNPMFCSPIQPYSMDAQIAQQQSYLPDAFSQQSRMTSLSWFVQSCPASSSFVQWTHAQQDQQDQLSEFLSYSWVREGQVVDTWDTDQKERRTKKTQDGKQEFRKHKSKHKI
[ 6728, 8126, 9086, 11620, 24917, 25367, 27929, 29164, 36354, 46581, 62588, 63774, 77935, 87402, 87407, 87857, 88001, 88008, 88273, 88274 ]
The following text describes a protein: Function: Tissue-specific splicing factor with potential implication in the regulation of alternative splicing during neuron and germ cell differentiation. Antagonizes SRSF1-mediated BCL-X splicing. May affect the choice of alternative 5' splice sites by binding to specific seque...
0
MAVSWIVFDLWLLTVFLGQIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLVGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFLHVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIFYAVCYMMVSLIFFIGFLLEDRVACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTMAGSVWWVILTITWFLAAVPKWG...
[ 6964, 7039, 7086, 7161, 9297, 11856, 12692, 13763, 13812, 13813, 14235, 15448, 16921, 17278, 17279, 18121, 19048, 20212, 21282, 24978, 25079, 25278, 25337, 25339, 25494, 25495, 25772, 26197, 26409, 26472, 27093, 28715, 30491, 30893, 32078, 36384,...
The following text describes a protein: Function: Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. ...
0
GTVFFDQDSPDSPVKVTGEVTGLQKHGFHIHEFGDNTNMSADGSSYLQVSGSKLTQEGQASMEVKGNAGARVAXGVVGIAK
[ 8435, 8959, 15949, 24878, 28880, 29024, 37130, 50940, 55824, 64179, 87411, 87567, 88038 ]
The following text describes a protein: Function: Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Subcellular Localization: Secreted.
0
MREIVTLQFGERSNYLGTHFWNTQESYFTYPPEAESPVNHDILFRPGIAPDGSDTFTPRALIYDLKGAFGSMRKINALYEPEDDRSILDQPGVWPSKPIVQRTQPIPPSTYQEHLDNGLDPPALNISSVRYWSDYSRVFYHPKSIAQLSEFDVNDTLMPFEKWEVGKGLFEKLEREVDLVDRDLRPFVEECDGIQGLQIFTGVDDAWGGWASGWIERLRDEYGKMSIWTWGLGDQGANAAVGRERRLQQMVNASQSLQTLGEQSSVYIPISNSPTKTPSYLSLDATSLWHVGALQAIGLESMTISSRLRTSVGGRGNLQD...
[ 8565, 24978, 24979, 47570, 52123, 59369, 64271, 75612, 87785 ]
The following text describes a protein: Function: Involved in the partitioning of the mitochondrial organelle and mitochondrial DNA (mtDNA) inheritance. Subcellular Localization: Mitochondrion.
0
MVNEPLDSQSTTTVTAQPIISIGKPSDDHDTQTSALSDTATIVALILRLIFGHTPWLVYRFLSYTVTATITLDLWSVLGLLSLISLVVYLLIRYRLLNTYTHLKTPAPIAPRAPFDLQPDATLDDDTDLNKGYPDEFMNAFLSSIKVFGYLDKPVFHELARHLQTRKLKTGEILFDEDSEDRDFYVVVDGCVQIYLKGNSNALARHSLGSNNFEDRSDSDDPEDEFSGHHLLNEVKAGETVSSLFTILSLFTEDFELSTLMQPHSAATNLNESHGTSFSSKHSGFPQAQSPAFSTQLDSDESAWLRFNHLQQDSSIDSTP...
[ 3972, 10604, 15681, 25008, 25014, 28482, 36430, 37129, 38123, 48241, 49123, 51166, 51167, 75956, 87432, 87601, 87729, 87731, 87760, 88008, 88159, 88161 ]
The following text describes a protein: Function: Intracellular phospholipase B that catalyzes the double deacylation of phosphatidylcholine (PC) to glycerophosphocholine (GroPCho). Plays an important role in membrane lipid homeostasis. Subcellular Localization: Endoplasmic reticulum membrane. Membrane.
0
MGRASKDKRDIYYRKAKEEGYRARSAYKLLQLHEEFGILRREEIRTGVVDLCAAPGSWSQVLSNHLCGSQPGSAAEACEGDEAINSEASQRPRIVAVDLQEMMPIDGVQLLQGDITSEWTAREIIRLLNGDSSSVPECSDATALSTAGAINDFNNGRGNNVSEEGKSSQQRSDCGVGLMNERNNASECVDGDNNNNNSNNNDDRNGGDAGASTRPVAGRKADLVVCDGAPDVTGMHELDEYLQHHLLLAALNITTFVLRRGGTFVTKMFRGPNTPFLVAKAEVFFRQVTIAKPKSSRNASMEAFMVCQNYDPPASYQPSF...
[ 2173, 7203, 7224, 11739, 24978, 29123, 35189, 38310, 48903, 58980, 59229, 75737, 87367, 87777, 88008, 88026, 88153, 88278 ]
The following text describes a protein: Function: Methylates the 2'-O-ribose of nucleotides at positions 32 and 34 of the tRNA anticodon loop of substrate tRNAs. Subcellular Localization: Cytoplasm.
0
MLRSLSVFVLLAVACCHAEEVKSKSKICANVFCGAGRECAITEKGEPTCLCIEECKPHKRPVCGSNGRTYRNHCELHRDACLTGLKIQVAHDGHCEEKKTEKSAASPIVCYLADRNELRNRVIEWLQTEVVPDGWFSKGSNFSEILHRYFKTYDDGDSQMDSAEFLKFIQHNETAVNISSYMDEENNRLLRSLCVDALIELSDENADWKLSFNEFLNCFKPGFNPTQKKCALEDETFEDGAETQVECNRCVCACGNWVCTAMTCDGQNKKTAPLEDTDLTGQEEMTEEEWTRRVEELNKHQETVEKSKKSSTKEK
[ 11620, 11749, 24878, 29025, 29141, 37640, 37895, 38901, 46081, 48833, 63842, 76308, 87413, 87522, 87552, 87914, 88008, 88009, 88038, 88058 ]
The following text describes a protein: Function: Secreted glycoprotein that is involved in various physiological processes, such as angiogenesis, regulation of the immune response, cell proliferation and differentiation. Plays a role in the development of the central nervous system, skeletal system, lungs, and ureter....
0
MGLIAIACGLIVALGALGASIGIAMVGSKYLESSARQPELIGPLQTKLFLIAGLIDAAFLIGVAIALLFAFVNPFAGA
[ 10591, 25079, 25848, 26421, 29172, 30332, 32555, 36311, 37916, 40973, 52797, 63722, 66141, 87109, 87238, 87274, 87276, 87598, 87601, 87676, 87733, 87760, 88008, 88159, 88161, 88162 ]
The following text describes a protein: Function: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a centra...
0
MMKIYLMGSDQRIVRCARVSFAKDSYVDEKRDKRLIRYLFKHRHASPFEHNIIAFEWKKEKWIELLSKLENPTVQVYYSNGFVFLNLRNAINVWELLPDAVKERIKEAFPTTYGVIQRRGEIEDEELYSLPYTKDKAYVKEKIETSSGWIGLVDKLELETDMDFYTFVVECPLFVARQWMRHRFGSYNEVSKRYVGKEFLEFYLPKYIRKQAEKNKQASVDEPISESEVFIKKIENLISKSVKLYEEIIEKGGAKELARGVLPQFMKTRFYWTVPRISLDNFITLRTHEGAQKEIREFAEAIKEMVGYRGTDKKNVI
[ 2113, 8034, 8037, 12244, 28618, 33679, 33700, 34296, 38921, 63876, 87004, 87455, 87470, 87777, 87823, 87853, 88008, 88153 ]
The following text describes a protein: Function: Catalyzes the reductive methylation of 2'-deoxyuridine-5'-monophosphate (dUMP) to 2'-deoxythymidine-5'-monophosphate (dTMP) while utilizing 5,10-methylenetetrahydrofolate (mTHF) as the methyl donor, and NADPH and FADH(2) as the reductant.
0
MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQ...
[ 7262, 7520, 8531, 8664, 10947, 15260, 25079, 25516, 28688, 31311, 31958, 38877, 38878, 41979, 46981, 47529, 63951, 76067, 87126, 87139, 87276, 87413, 87522, 87616, 87618, 87760, 87914, 87976, 88006, 88008, 88009, 88058, 88159, 88161 ]
The following text describes a protein: Function: May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhib...
0
MAEAALEGTEPVDLSKHPSGIIPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEQQSKLAARKYARIIQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHGAFSSYEPELFPGLIYRMKQPKIVLLIFVSGKIVLTGAKVREETYTAFENIYPVLTEFRKVQQ
[ 8098, 24917, 27904, 30147, 36617, 46245, 59839, 61957, 87384, 87857, 88008, 88148 ]
The following text describes a protein: Function: General transcription factor that functions at the core of the DNA-binding multiprotein factor TFIID. Binding of TFIID to the TATA box is the initial transcriptional step of the pre-initiation complex (PIC), playing a role in the activation of eukaryotic genes transcrib...
0
MTEEPTKENLGGPKSPTPVTMEKSPKSEVVVTTVPLVSEVQLTAATGGAELSCYRCIIPFAVVVFITGIVVTAVAYSFNSHGSVISILGLVLLSSGLFLLASSALCWKVRQRNKKVKRRESQTALVVNQRSLFA
[ 6890, 6911, 6947, 7707, 7708, 8706, 11748, 15202, 16521, 17039, 17054, 17790, 19082, 24646, 25008, 25079, 26218, 26465, 61284, 87276, 87367, 87402, 87407, 87432, 87760, 87914, 88008, 88159, 88161 ]
The following text describes a protein: Function: Plays a role during embryonic arterial endothelium differentiation and vascular morphogenesis through the ACVRL1 receptor-dependent signaling pathway upon stimulation by bone morphogenetic proteins, such as GDF2/BMP9 and BMP10. Involved in the regulation of nociception,...
0
MEKYNAIKIVKGSGGFGGPLTVKPEEGKDTLLYITGGGAEPEIVEKIVNLTGCKAVNGFKTSVPEEQIFLVIIDCGGTLRCGIYPQKRIPTINVMPVGKSGPLAKFITEDIYVSAVGLNQISLADSSAEPIKSTKVPEEGKREFKYSADKKVSQSLAENSKSSIVQKIGMGAGKVVNTLYQAGRDAVQSMITTILPFMAFVAMLIGIIQGSGFGNWFAKILVPLAGNGIGLMILGFICSIPLLSALLGPGAVIAQIVGTLIGVEIGKGTIPPSLALPALFAINTQCACDFIPVGLGLAEAEPETVEVGVPSVLYSRFMIG...
[ 3489, 9291, 25079, 29579, 30159, 34600, 39846, 45731, 45746, 87276, 87694, 87760, 87914, 87915, 88087, 88153, 88159, 88161, 88162 ]
The following text describes a protein: Function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II complex...
0
MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKPQEAVYGQNDIHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPERKFMQTFVLAPEGSVPNKFYVHNDMFRYEDEVFGDSEPELDEESEDEVEEEQEDRQPSPEPVQENANSAYYDAHPVTNGIEEPLEESSHEPEPEPESETKTEELKPQVEEKHLEELEEKSATPPPAEPASLPQEPPKAFSWASVTSKNLPPSGTVSSSGIPPHVKAPVSQPRVDAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDSD...
[ 8725, 12862, 15044, 16634, 16763, 25040, 25296, 27925, 35466, 36354, 37663, 46581, 50988, 61424, 62503, 63774, 66860, 87139, 87367, 87616, 87662, 87684, 87776, 87914, 88001, 88008, 88162, 88180, 88275 ]
The following text describes a protein: Function: Scaffold protein that plays an essential role in cytoplasmic stress granule formation which acts as a platform for antiviral signaling. Plays an essential role in stress granule formation. Stress granules are membraneless compartments that store mRNAs and proteins, such...
0
MCLLRLPVTLLVLCVALNELKATSIASDTGHQVGKRKCNTATCATQRLTNFLVRSSHNLGAALLPTDVGSNTYGKRNAPQISDRELLHYLPL
[ 10955, 11698, 15141, 15260, 15320, 16523, 20256, 21079, 24907, 26197, 28880, 32073, 33211, 36303, 37350, 51100, 53185, 53186, 87142, 87150, 87317, 87413, 87567, 88008, 88038, 88058 ]
The following text describes a protein: Function: Amylin/IAPP is a glucoregulatory peptide hormone that plays an important role in the regulation of energy homeostasis (By similarity). Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose me...
0
MFQWYQRSLIQRPLLTQSLTTACLFAVGDSLAQQAVEKRGIAQHDVARTGRMAFYGGGNVQPFPYKLPLLTVVAVFGPLATKWFQVLQRRINLPSAQRTVVGRVAADQLLFAPTMIGVFLSSMSVLEGGSLSEKLERSYWPALKANWTVWPFLQLVNFALVPLQFRVLTVNVLNIGWNCFLSLSNNVGSQDVPLVA
[ 24978, 24979, 24983, 42103, 87760, 87785, 87786, 88008, 88159, 88161 ]
The following text describes a protein: Function: May be involved in cellular response to stress. Required to maintain mitochondrial DNA (mtDNA) integrity and stability (By similarity). Subcellular Localization: Mitochondrion inner membrane; Multi-pass membrane protein.
0
MLFKKDRKQETAYFSDSNGQQKNRIQLTNKHADVKKQLKMVRLGDAELYVLEQLQPLIQENIVNIVDAFYKNLDHESSLMDIINDHSSVDRLKQTLKRHIQEMFAGVIDDEFIEKRNRIASIHLRIGLLPKWYMGAFQELLLSMIDIYEASITNQQELLKAIKATTKILNLEQQLVLEAFQSEYNQTRDEQEEKKNLLHQKIQETSGSIANLFSETSRSVQELVDKSEGISQASKAGTVTSSTVEEKSIGGKKELEVQQKQMNKIDTSLVQIEKEMVKLDEIAQQIEKIFGIVTGIAEQTNLLSLNASIESARAGEHGKG...
[ 8522, 8663, 9322, 25325, 30786, 30838, 32536, 39288, 43619, 46244, 66736, 70674, 87103, 87541, 87678, 87767, 88008, 88152 ]
The following text describes a protein: Function: Heme-containing signal transducer responsible for aerotaxis, the migratory response toward or away from oxygen.
0
MAVTEAVKEAIWMIGMVQELGIEQKNVNVYCDNQSAIHLTKHQVFHERSKHIDVRLNFVRNTVSKGRIKVEKVHTDDNAADMLTKSLPVSKFKYCMDLVSCYILYTLNPDVSGASTLFNDIFGAFGIGNNPETVPCCSWENSSPATSNCLYHTVTKFLESLIDNTHNCLHLRLLDKHCPSDPRTEMQVRFLELGSRKPSTCYCRKEDVESFVWAICRRIVPPKLLGEHSNWRILRTNIFKFIRLRKFEKFSLKECFHNLKISKFPLLHDNIHNGCSVLGITDIARHVILGCWIFWFFKCLVSPLFQANFYVIESEFERNE...
[ 3731, 8564, 24761, 24785, 27924, 32009, 32536, 34243, 36329, 38838, 53887, 74934, 87306, 87747, 87767, 87856, 87857, 88002, 88008, 88125, 88153 ]
The following text describes a protein: Function: Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes. It elongates telomeres. It is a reverse transcriptase that adds simple sequence repeats to chromosome ends by copying a template sequence within the RNA comp...
0
MAASSGSPQLATEDHLRKGEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRGGAWAIAATTLTTGLIFGIYETCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLLEPTRAPQLPA
[ 11877, 23866, 24983, 29897, 34579, 37655, 50913, 55191, 87760, 87785, 87786, 88008, 88009, 88159, 88161, 88162 ]
The following text describes a protein: Function: Mitochondrial transporter that mediates uptake of thiamine pyrophosphate (ThPP) into mitochondria. Subcellular Localization: Mitochondrion inner membrane; Multi-pass membrane protein.
0
MAAAPQAPGRGSVRKTRPLPVKTSLNNPYSICWGVLDREDMHFILQTLEDRIQSLGLQKIEDRKRKKKQPPLKKQSGDTSSIDVDTGEDLKKEKPKGDAQASGWTPVDVRKQLAIGINEVTRALERNELLLALACKSAKPAIVTSHLVQLSVSRGVPACQVPRLSERLAPVLGLKCVLALGFKRNTTAFGEELRAILPRVPRLNVAWLQDALEDPRENLQTESLESQDEEILDTSFEDLSKPKRKLAEGQQPVVLQPLKIKKLIPNPNKIRKPPKSKRTASK
[ 6939, 8109, 24734, 24838, 24927, 24974, 25523, 28407, 31374, 39242, 59230, 69635, 87115, 87857, 87914, 88008, 88276, 88278 ]
The following text describes a protein: Function: Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences. Subcellular Localization: Nucleus, nucleolus.
0
MLPSQEASKLYHDNYVRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVNTPKPGYFGLFHYCVGSGLAGRELACRGSFTDFSTIPSGAFQAAAFFVLLSMVLTLGCITCFALFFFCNTATVYKICAWMQLLAALCLVLGCMIFPDGWDAETIRDMCGEKTGKYSLGDCSVRWAYILAIIGILNALILSFLAFVLGNRQNDLLHEELKTESKGGRCATRFCRHREDIRPSTRSRTSSRGRRPGRSLPVLPLICRRWPRSAPGRTARTGAVPAARRAHVHTDTAIPRTPPAPHLRRRRGRMPQTRFV
[ 8970, 20094, 20588, 23629, 25079, 25495, 26414, 26492, 27095, 27136, 33702, 51919, 87276, 87278, 87760, 87943, 88008, 88097, 88159, 88161 ]
The following text describes a protein: Function: Plays a role in the regulation of inhibitory synapse formation and function by being involved in maintening gamma-aminobutyric acid receptors (GABAARs) clustering and their associated scaffold proteins at inhibitory synaptic sites. Acts in concert with NLGN2 to recruit ...
0
MAASEENSALFPIFILTIMALPLVPYTVMKLCRAASRKTKVIHCQCADCSRSGKYRKSIFKRISNFSTCSNLTLVLLWIIMIFLVYYIKNMSGEIQVFEPYSILGLEPGASDAEIRKAYRRLSILYHPDKNPDPAAHKHFVEYIVKAYQALTDPISRENYEKYGHPDGRQGFQMGIALPQFLLDIDGASGGILLLWIVGVCILLPLVIAVIYLSRSSKYTGNYVMHQTLSTYYYLMKPSLAPSKVMDVFTKAAEYVEIPVRRTDDEPLQKLFMSVRSELNLDLKNIKQEQAKFWKQHPAIVKTELLIQAQLTRESAALSP...
[ 8292, 8295, 25596, 29185, 37291, 39369, 48276, 63695, 64599, 87285, 87432, 87522, 87760, 87974, 88008, 88159, 88161, 88162 ]
The following text describes a protein: Function: Required for integral membrane and secreted preprotein translocation across the endoplasmic reticulum membrane. Subcellular Localization: Endoplasmic reticulum membrane; Multi-pass membrane protein.
0
MNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETQEEVDTALAQLKELYPEEEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASVTGIFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGNPPEIMEGYLKALPMKRMLEPEEIANVYLFLASDLASGITATTVSVDGAYRP
[ 266, 8364, 9035, 11768, 16776, 22499, 24978, 30232, 31277, 31443, 31466, 34297, 37894, 52988, 64058, 75914, 87103, 87731, 87822, 87873, 88078 ]
The following text describes a protein: Function: Involved in the multi-step bile acid 7alpha-dehydroxylation pathway that transforms primary bile acids to secondary bile acids in the human gut. Catalyzes the oxidation of C3-hydroxyl group of CoA conjugated bile acids generating a C3-oxo bile acid intermediate. Can use...
0
MHFKLLLLAALVLLFSTATHASVGGYICPNDRKKLLTVLVKALINVEGDFSTPYYGIKGFKALNEQVAAVLVKDNCAHIKKYYKADCTPEENFQGLSAWNLLGCSGKLHTDATITNLRTVLESDKSTTSDIRYAAETLKLLGAAIPNGAKVAQLIQAKLKEDDSLQSLGHALHAAALLGTSGNFIQDRIEEVVVQADEVDGKLLQWEGGLTTTSLLITGLLRFPGAKPLNAQQAEKLATYLLTRRTVQTPKGALALLEATTSLASSDISPVSITIAGPAQVTLDKPELKVHISDILGRALKAPPTPVVAQSATRITDDVV...
[ 8189, 25147, 43429, 87432, 87760, 88008, 88058, 88159, 88161 ]
The following text describes a protein: Function: Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascen...
0
MDSPSLLEVLQVQQVEKLISPSLRFILAYFTHRYPRFLLRAYNSFDGIYLLVKLLLEKSQLKKWNATSVERRFQLKRVIAVRDSSIIAEEFPQESESATSLNGIDVLKKLFLTYCIPYLLEKCESLTTVKENHTAVSILSLQARDKQKGALSVFYSKIKILLVRLKKILHFVFRLIRKSNTYLQWLYYLLYALGKTPYTNLADHILRQRVIYNVENIHSRKLISTREKSSLLTSIADHSMEGFLIIIQLIDWWQSNNYESHLKKGEVAFTELAPPKLPFEINVSTTDICKICGEKIKNPAVLSTGFVFCYPCIQVWLQRH...
[ 8203, 10748, 10752, 25005, 27507, 28656, 29166, 34103, 41762, 46929, 50276, 87760, 87767, 87894, 87974, 88008, 88159, 88161, 88162, 88181, 88261, 88263 ]
The following text describes a protein: Function: Component of a retrotranslocation channel required for peroxisome organization by mediating export of the PEX5 receptor from peroxisomes to the cytosol, thereby promoting PEX5 recycling. The retrotranslocation channel is composed of PEX2, PEX10 and PEX12; each subunit c...
0
MTPAEIAPKDRLIVALDLPSVDAAEAMIARLGDSVTFYKIGYRLAYAGGLPLVARLADKGKKVFLDLKLHDIGNTVAQGVESITRLGATFLTVHAYPQTMKGAVEGRGGSNLKILAVTVLTSYNEDDLHAAGFRLGVAELVEARAQQAQVLGIDGLVSSPEEVGALRKIVGHQMSLVTPGIRPAGSASGDQKRIMTPGRAITAGADYLVVGRPVVEAAEPKAIADAIQAEIGQALGA
[ 5272, 8013, 14816, 25040, 28455, 37403, 45333, 47531, 48258, 50896, 73549, 87388, 87741, 87988, 88008 ]
The following text describes a protein: Function: Catalyzes the decarboxylation of orotidine 5'-monophosphate (OMP) to uridine 5'-monophosphate (UMP).
0
MHLPMEEGREKSSTQQDSEITAQDERIDPNATILSHSVLSLLVPKVEYVQGSVKEITKTQNVLAKSVEQENEKFRQIGYIHDLSNTFIRCRRCRFKLVNIRREMLNLSDRMNKLKKRAARLKSIREKQQLKQAQEEAERQAYQASLLAKPAKHLTNQN
[ 25473, 25578, 50155, 58758, 87326, 87367, 88008 ]
The following text describes a protein: Function: Component of the biogenesis of lysosome-related organelles complex-1 (BLOC-1) involved in pigment granule biogenesis. Subcellular Localization: Cytoplasm.
0
MSLADELLADLEEAGDEGDEPGLYPGAEGADGADSDGEGGAEGPGGLADIPEEMEVDYSGTESVTSIAKLRHSKSFAEIMEKISQYIGNQRKTSEVSGPVEADPEYRLIVDANNLTVEIDNELSECPACSLPPTTLSTKGCPLFAVLCALELGNNLDKCKNNETLQQILTNATIMVVSVTASTTQGVLLGDEELLRLEEACDMALELNQSKHSIYEYVESRMSFIAPNLSIIVGASTAAKIMGIAGGLTNLSKMPACNLMLLGAQRRSLSGFSSTSLLPHTGYIYHSDIVQSLPPDLRRKAARLVSAKCTLASRVDSFHE...
[ 6687, 6728, 6736, 17250, 24951, 26439, 26705, 26949, 38162, 51755, 58101, 63852, 69218, 87857, 88008, 88020 ]
The following text describes a protein: Function: Involved in pre-mRNA splicing as component of the spliceosome. Required for the assembly of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome. Subcellular Localization: Nucleus.
0
MSGDDDWWTSSNEALLVSLVTPSDTGVKTLDTFHPEYTNNIFGEKEQIFGYKGLRINLQYNASDMLPNLKVSYKKKYQPTADEEALDINEVLSEFLPEIAFQKQSDFETRLKSIPDNWTPPGTLVTSFTNKDGEYEVYSGKITDPAVKQLLNRIQILVPFFVDGGTPIDMEDPDVDRWTIYFLYNKRPLLNQPDKFSYHFAGYSTLYRYYAFQPPAESESKTPTDTPTFSVDGDFDLDTLPCRTRISQFIIIPPFQQKGLGSRLYSIIYQQYLKHEPTIELTVEDPNEAFDDMRDLADLAFLSKQPEFQALKIDTSVEIP...
[ 2673, 8065, 12059, 24785, 24917, 24978, 29733, 32042, 47303, 49230, 50281, 52007, 64820, 87125, 87302, 87367, 87374, 87380, 87857, 88008, 88153 ]
The following text describes a protein: Function: Catalytic component of the histone acetylase B (HAT-B) complex. Acetylates 'Lys-12' of histone H4 which is required for telomeric silencing. Has intrinsic substrate specificity that modifies lysine in recognition sequence GXGKXG. Involved in DNA double-strand break repa...
0
MDTFKRWLNKPKADDKSLLARFFHADRSLTAVASELDSFDGRAEPDRCTRLVSRLRQNQDKVLAITNLIMEELLGEDRDPRAFRAKFPEEVLQENLAGQLWFGAECLAAGSSIMNRETESKEMRPLAQAVTKSLGNVRVLLRDQCLKNNVPNSKTLHLDLNDSTTEQLYESLKIFDRLFAEFELSYVSAMVQVKSRHEYEMQQWIGVLFSETLQRALKIGLLDQEMVDAFDPGLMFSIPRLAIVAGLVVYAKGPLNMDMPGDQLSEMFRPFRTILIKIRDLLRNLNNQELYQLEKLLCTNEDINTKVPLGSSSIEAPSPE...
[ 14048, 25696, 29166, 36191, 45292, 46929, 50341, 69910, 76772, 87767, 87914, 88008, 88261, 88263 ]
The following text describes a protein: Function: Negative regulator of epidermal growth factor receptor (EGFR) signaling.
0
MSKEKLPFVVTAGQMRSAEEAAVVRGTTWAALMEQAGAGVADAVLRYAAPLANRQVLVLVGPGNNGGDALVAARHLADAGALVTLYVWRRSGVDANLQACRERAIPELSAATDGDGSLLAQALRKAVLVLDGLLGTGARPPTADLATIIQAVNAERTQRSDLRVVAIDLPSGVGADDGQVPTVAIRADLTVATGLIKRGLLLWPGRGYAGEIVVAPIGLSSLDGVLTMSELLTASQARTLLPPRPADAHKGVFGKVLVVAGSINYPGAAVLACAGAQRSGAGLVTLATGRTVLSLATLPPEVTLLPVAEGDWGAIGPAAV...
[ 5481, 6053, 15698, 20693, 25325, 29033, 30159, 32536, 33991, 33992, 36459, 39602, 50795, 59222, 59915, 64395, 87012, 87016, 87110, 87683, 87694, 87741, 87760, 87767, 87814, 87822, 87823, 87855, 87945, 88008, 88153, 88159, 88161 ]
The following text describes a protein: Function: Bifunctional enzyme that catalyzes the epimerization of the S- and R-forms of NAD(P)HX and the dehydration of the S-form of NAD(P)HX at the expense of ADP, which is converted to AMP. This allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a...
0
MAKSSLGQDSDSTAAVAVLKRAVELDAESRYQQALVCYQEGIDMLLQVLKGTKESSKRSTLRTKISGYMDRAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLQETVTEVWIEDPYIRQTHQLYNFLRFCEMLIKKPCKVRTIHLLTSGDEGFGNTQQSSGLEEIKQSLRSHGVVLEINYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQGRFSLGYCDLDLRPCHETTVDIFHNKHTKKI
[ 6697, 18246, 25325, 25506, 25697, 30814, 31754, 32073, 42175, 61110, 63953, 65631, 71541, 78465, 87272, 87273, 87434, 87760, 88008, 88162 ]
The following text describes a protein: Function: Required for efficient abscission at the end of cytokinesis, together with components of the ESCRT complexes. Seems not to be involved in endosomal transport (By similarity). Subcellular Localization: Late endosome membrane; Peripheral membrane protein; Cytoplasmic side...
0
MALNAPSGSCSSKVLLHPLVIMQMSEHYSRTKVQQGPTVKKVFGAILGRQNGRQVEAINSFVLKMETEEMAEPVTFSTEHLLQRADQYLEVFPELQVIGLYCAGEDDNLTPEEKPLLSKLTNAVRNSEKAGQIDATLFLKLNSITAGTTRKLPLFAFEADVTDQEKHKPIEWILVSEESERVGVNHIAKLSTKHGKDGKSVGKKHAEAQDAAMSMLQNRVDLIVAYLEKVQDGTLQPNFEILKEANLLAQKLKTIDRYAAEFTDSFEKEEKTMTVFSLMPRLTTLLGNMQNVWNKLSAQRADLLADDGFHGKSTSRWAHP...
[ 16123, 17352, 23703, 24917, 24978, 25142, 29148, 36397, 56492, 65177, 87367, 87402, 87407, 87857, 87863, 88008, 88062 ]
The following text describes a protein: Function: Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-typ...
0
End of preview. Expand in Data Studio

PLAT: Protein Language Alignment Tuples

plat_data is a curated, cluster-split dataset of protein sequences paired with structured functional annotations and natural-language descriptions. It is designed to train and evaluate cross-encoder alignment models (Vec2Vec, Mat2Mat) that map representations between different protein language models (PLMs), or between PLMs and natural-language encoders.

Each row contains:

  • a protein sequence (amino-acid string),
  • an annotation list of integer IDs covering Gene Ontology, EC numbers, InterPro, Gene3D, cofactors, and UniProt keywords,
  • a description string assembled from UniProt free-text curation (function, miscellaneous notes, subcellular localization, domain).

Dataset Schema

Field Type Description
sequence string Canonical amino-acid sequence in single-letter IUPAC code.
annotation list[int] Sorted, deduplicated integer IDs decoded via the label2id.pkl vocabulary produced by data/process_uniprot_av.py. Each ID corresponds to a typed annotation key of the form "<value>_<suffix>" where suffix is one of bp, cc, mf, ec, cofactor, ip, threed, keywords.
description string Structured free-text block beginning with "The following text describes a protein:" and containing any present of Function:, Miscellaneous:, Subcellular Localization:, Domain: subsections. Every row is guaranteed to contain a Function: block (see "Preferential sampling" below).
labels int Placeholder column (always 0), added by data/add_dummy_labels.py so downstream Trainer pipelines that expect a labels key work without modification.

Splits

The dataset has three splits: train, valid, and test. Splitting is performed at the cluster level (see "Clustering and splitting" below), so no sequence in valid or test shares more than ~40% identity with any sequence in train.

Data Source

The primary upstream source is UniProtKB, restricted to entries with manually curated Gene Ontology annotations (the "GO manual" subset). Two snapshots are used:

  • uniprotkb_go_manual_2025_11_18.tsv.gz (1,380,840 entries) for structured annotations.
  • uniprotkb_go_manual_2025_12_02.tsv.gz (1,380,840 entries) for free-text descriptions.

Columns pulled from the UniProt TSV are:

UniProt column Used for Parsing
Entry record key verbatim
Sequence sequence verbatim
EC number annotations split on ;, strip
Cofactor annotations parse Name=<x> from each COFACTOR: entry
Gene Ontology (biological process) annotations extract GO:xxxxxxx IDs
Gene Ontology (cellular component) annotations extract GO:xxxxxxx IDs
Gene Ontology (molecular function) annotations extract GO:xxxxxxx IDs
InterPro annotations split on ;, drop trailing empty
Gene3D annotations split on ;, drop trailing empty
Keywords annotations split on ;, strip
Function [CC] description see text cleaning
Miscellaneous [CC] description see text cleaning
Subcellular location [CC] description see text cleaning
Domain [CC] description see text cleaning

Annotation vocabulary

data/process_uniprot_av.py streams the UniProt TSV twice. The first pass builds a label2id dictionary whose keys are typed strings (e.g. GO:0016310_bp, 1.1.1.1_ec, IPR000878_ip, ATP-binding_keywords, K(+)_cofactor). The second pass emits camp_data.csv with columns [sequence, annotations], where annotations is the sorted, deduplicated list of integer IDs for that protein. The label2id.pkl and id2label.pkl files are the authoritative mapping used throughout the pipeline. The resulting table is pushed to the intermediate dataset lhallee/camp_data_11_2025.

Description assembly

data/process_uniprot_cc.py builds the free-text description by concatenating the four CC columns in order (Function, Miscellaneous, Subcellular location, Domain), each under its own header. Text cleaning removes:

  • (PubMed:...) inline citations,
  • {ECO:...} evidence codes,
  • UniProt CC prefixes (FUNCTION: , MISC: , SUBCELLULAR LOCATION: , DOMAIN: ),
  • redundant whitespace and stray punctuation artifacts from the removals above.

A resulting row looks like:

The following text describes a protein:
Function:
Catalyzes the reversible conversion of methylmalonyl-CoA to succinyl-CoA...
Subcellular Localization:
Mitochondrial matrix...

Build Pipeline

The full pipeline is four stages. All scripts live under data/ in the source repo.

Stage 1: UniProt ingestion and annotation curation

  • Input: uniprotkb_go_manual_2025_11_18.tsv.gz and uniprotkb_go_manual_2025_12_02.tsv.gz.
  • data/process_uniprot_av.py produces camp_data.csv (sequence + integer annotation list) and the label2id.pkl / id2label.pkl vocabulary files.
  • data/process_uniprot_cc.py produces seq_descriptions.tsv (entry + sequence + structured description).

The sequence-keyed dictionaries seq_annotation_dict.pkl and seq_description_dict.pkl are later used by the final assembly step to look up annotations and descriptions by exact sequence match.

The annotation table is pushed to lhallee/camp_data_11_2025 as an intermediate artifact.

Stage 2: Deduplication

Before clustering, exact-duplicate sequences are removed with drop_duplicates(subset=['sequence']) (see data/build_dataset.py).

Stage 3: Clustering and splitting

Clustering and split assignment are performed by data/build_dataset.py:

  • Sequences are written to a FASTA file with integer IDs.
  • CD-HIT is invoked inside a Docker container built from the official CD-HIT Dockerfile.
  • Identity threshold: 0.4 (40% sequence identity), word size -n 5. This is the threshold actually used for the published PLAT release, as recorded by the cluster filename output_lhallee_camp_data_11_2025_0.4.clstr.
  • The .clstr output is parsed into cluster_dict: {cluster_id -> [seq_ids]} and id_seq_dict: {seq_id -> sequence}.
  • Clusters are shuffled and partitioned:
    • 5% valid clusters, 5% test clusters, 90% train clusters.
  • The four working pickles (cluster_dict.pkl, id_seq_dict.pkl, final_cluster_dict.pkl, seq_annotation_dict.pkl) are uploaded to an auxiliary private repo for reproducibility.

Because splits are assigned by cluster, any two sequences in different splits are less than ~40% identical under CD-HIT's greedy incremental clustering, which gives a realistic generalization benchmark for PLM alignment.

Stage 4: PLAT assembly (preferential sampling)

data/build_plat_data.py produces the final dataset:

  1. For each cluster in each split, gather all member sequences.
  2. Keep only sequences for which both an annotation and a description exist.
  3. Keep only the subset whose description contains the literal substring "Function:" (that is, sequences with at least a UniProt Function [CC] annotation after text cleaning).
  4. Pick one sequence uniformly at random from that subset (seed 42).
  5. If no candidate survives, the cluster is skipped entirely. This biases PLAT toward clusters containing at least one well-characterized member.
  6. The resulting records (sequence, annotation, description) are assembled into a DatasetDict(train, valid, test) and pushed to lhallee/plat_data.

A final labels column of constant 0 is added by data/add_dummy_labels.py for compatibility with generic Trainer pipelines.

Reproducing the Build

# 1. Parse UniProt TSV into annotations + vocabulary
py -m data.process_uniprot_av
# -> camp_data.csv, label2id.pkl, id2label.pkl
# -> pushes lhallee/camp_data_11_2025

# 2. Parse UniProt TSV into descriptions
py -m data.process_uniprot_cc
# -> seq_descriptions.tsv

# 3. Cluster with CD-HIT and split by cluster (requires Docker)
py -m data.build_dataset \
    --hf_token <token> \
    --dataset_path lhallee/camp_data_11_2025 \
    --similarity_threshold 0.4 \
    --n 5 \
    --valid_percentage 0.05 \
    --test_percentage 0.05

# 4. Assemble PLAT with preferential Function-aware sampling
py -m data.build_plat_data \
    --hf_token <token> \
    --repo_name lhallee/plat_data \
    --seed 42

Intended Use

PLAT was constructed to train and evaluate representation-alignment models:

  • Vec2Vec: align pooled (mean + variance) embeddings from one PLM to another, or from a PLM to a natural-language encoder of the description field.
  • Mat2Mat: align full residue-by-residue embedding matrices between two PLMs.
  • Cross-modal retrieval: use the description column with a text encoder (for example ModernBERT or GPT-OSS) and the sequence column with a PLM (for example ESMC-600), then evaluate whether aligned embeddings retrieve each other.

Typical consumption patterns in the source repo read columns as (sequence, sequence), (sequence, description), or (description, description) pairs.

Licensing and Attribution

All sequences and annotations are derived from UniProtKB and are redistributed under the UniProt terms of use (Creative Commons Attribution 4.0, CC BY 4.0). If you use PLAT, please also cite UniProt:

The UniProt Consortium. UniProt: the Universal Protein Knowledgebase in 2025. Nucleic Acids Research, 2025.

And the dependent databases surfaced in the annotation vocabulary: Gene Ontology, Enzyme Commission (IUBMB), InterPro, Gene3D, and the UniProt Keyword ontology.

Known Limitations

  • Manual-annotation bias. Only UniProt entries with manually curated GO terms are considered, and only clusters containing at least one member with a Function [CC] block appear in the final dataset. Taxa and protein families that are underrepresented in Swiss-Prot are correspondingly underrepresented here.
  • One representative per cluster. Within-cluster diversity (paralogs, species variants) is not preserved: each cluster contributes a single randomly chosen, function-annotated representative.
  • Descriptions are post-processed. PubMed citations, ECO evidence codes, and the CC-prefix tags are stripped, which simplifies downstream tokenization but loses provenance information relative to the raw UniProt text.
  • Integer annotation labels are only meaningful via label2id.pkl. The integer space mixes eight annotation types; training code that treats it as a single flat multi-label target should be aware that different IDs correspond to semantically different taxonomies.
  • Snapshot-frozen. PLAT is built from a fixed UniProt release (manual-GO subset, November-December 2025) and will not reflect later curation updates until rebuilt.
Downloads last month
53