The full dataset viewer is not available (click to read why). Only showing a preview of the rows.
Error code: DatasetGenerationError
Exception: ArrowTypeError
Message: ("Expected bytes, got a 'list' object", 'Conversion failed for column Socs36E with type object')
Traceback: Traceback (most recent call last):
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/packaged_modules/json/json.py", line 137, in _generate_tables
pa_table = paj.read_json(
File "pyarrow/_json.pyx", line 308, in pyarrow._json.read_json
File "pyarrow/error.pxi", line 154, in pyarrow.lib.pyarrow_internal_check_status
File "pyarrow/error.pxi", line 91, in pyarrow.lib.check_status
pyarrow.lib.ArrowInvalid: JSON parse error: Column() changed from object to string in row 0
During handling of the above exception, another exception occurred:
Traceback (most recent call last):
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 1855, in _prepare_split_single
for _, table in generator:
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/packaged_modules/json/json.py", line 167, in _generate_tables
pa_table = pa.Table.from_pandas(df, preserve_index=False)
File "pyarrow/table.pxi", line 3874, in pyarrow.lib.Table.from_pandas
File "/src/services/worker/.venv/lib/python3.9/site-packages/pyarrow/pandas_compat.py", line 611, in dataframe_to_arrays
arrays = [convert_column(c, f)
File "/src/services/worker/.venv/lib/python3.9/site-packages/pyarrow/pandas_compat.py", line 611, in <listcomp>
arrays = [convert_column(c, f)
File "/src/services/worker/.venv/lib/python3.9/site-packages/pyarrow/pandas_compat.py", line 598, in convert_column
raise e
File "/src/services/worker/.venv/lib/python3.9/site-packages/pyarrow/pandas_compat.py", line 592, in convert_column
result = pa.array(col, type=type_, from_pandas=True, safe=safe)
File "pyarrow/array.pxi", line 339, in pyarrow.lib.array
File "pyarrow/array.pxi", line 85, in pyarrow.lib._ndarray_to_array
File "pyarrow/error.pxi", line 91, in pyarrow.lib.check_status
pyarrow.lib.ArrowTypeError: ("Expected bytes, got a 'list' object", 'Conversion failed for column Socs36E with type object')
The above exception was the direct cause of the following exception:
Traceback (most recent call last):
File "/src/services/worker/src/worker/job_runners/config/parquet_and_info.py", line 1436, in compute_config_parquet_and_info_response
parquet_operations = convert_to_parquet(builder)
File "/src/services/worker/src/worker/job_runners/config/parquet_and_info.py", line 1053, in convert_to_parquet
builder.download_and_prepare(
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 925, in download_and_prepare
self._download_and_prepare(
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 1001, in _download_and_prepare
self._prepare_split(split_generator, **prepare_split_kwargs)
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 1742, in _prepare_split
for job_id, done, content in self._prepare_split_single(
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 1898, in _prepare_split_single
raise DatasetGenerationError("An error occurred while generating the dataset") from e
datasets.exceptions.DatasetGenerationError: An error occurred while generating the datasetNeed help to make the dataset viewer work? Make sure to review how to configure the dataset viewer, and open a discussion for direct support.
updated list |
|---|
[
{
"content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.",
"role": "system"
},
{
"content": "Complete this networ... |
[
{
"content": "Generate a protein network in compressed BioPAX format with the following properties:\n- Proteins: AdSL, CG15631, CG18528, CG2930, CG4617, Fem-1, Sec10, lva, tRNA:Q:34E\n- Network density: approximately 0.22\n- Hub proteins (highly connected): tRNA:Q:34E, CG18528\n- Total interactions: approximate... |
[
{
"content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.",
... |
[
{
"content": "Generate a protein network in compressed BioPAX format with the following properties:\n- Proteins: AkhR, CCAP, CCAP-R, CG5890\n- Network density: approximately 0.50\n- Hub proteins (highly connected): CCAP, CG5890\n- Total interactions: approximately 3",
"role": "user"
},
{
"content": ... |
[
{
"content": "Generate a protein network with the following properties:\n- Proteins: Bcl9l, CTNNB1, Shank3, Yap1\n- Network density: approximately 0.67\n- Hub proteins (highly connected): Bcl9l, CTNNB1\n- Total interactions: approximately 4",
"role": "user"
},
{
"content": "<biopax>\n <proteins>\n ... |
[
{
"content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.",
"role": "system"
},
{
"content": "Complete this networ... |
[
{
"content": "Generate a protein network with the following properties:\n- Proteins: K01C8.1, elks-1, glh-1, klp-11\n- Network density: approximately 0.67\n- Hub proteins (highly connected): K01C8.1, glh-1\n- Total interactions: approximately 4",
"role": "user"
},
{
"content": "<biopax>\n <proteins... |
[
{
"content": "Complete this partial protein network in compressed BioPAX format:\n<biopax>\n <proteins>\n <p id=\"bubr1\" name=\"BubR1\" uniprot=\"F8WLE2\"/>\n <p id=\"cg11380\" name=\"CG11380\" uniprot=\"A0A0M4ER81\"/>\n <p id=\"cg13476\" name=\"CG13476\" uniprot=\"Q7KUL3\"/>\n <p id=\"cg15087\" n... |
[
{
"content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.",
"role": "system"
},
{
"content": "Complete this partia... |
[
{
"content": "Complete this partial protein network in compressed BioPAX format:\n<biopax>\n <proteins>\n <p id=\"f15e11.14\" name=\"F15E11.14\" uniprot=\"G5EBF3\"/>\n <p id=\"f26d2.15\" name=\"F26D2.15\" uniprot=\"G5ECL7\"/>\n <p id=\"w09d10.4\" name=\"W09D10.4\" uniprot=\"O18183\" fullname=\"Protein... |
[
{
"content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.",
"role": "system"
},
{
"content": "Complete this networ... |
[
{
"content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.",
... |
[
{
"content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.",
"role": "system"
},
{
"content": "Complete this partia... |
[
{
"content": "Predict the protein interaction network:\n\nPROTEIN: CG5147\n UniProt ID: A0A0M3QWY8\n Organism: Drosophila busckii\n Sequence Length: 400 amino acids\n Sequence: MPAKKAAAAAAPVAAAANGMTRLTPARDLTLGGRGGAAANKKVFAPNLNAVRNKNTNVKTSKDFTQPRGGRARGGRGSAAGATRGRGGGGNSTLIQTTGVFSEGAGAVHLRKSTSAAGGGGGSSY...INL... |
[
{
"content": "Predict the protein interaction network:\n\nPROTEIN: dcr-1\n UniProt ID: A0A0C9QPE9\n Organism: Fopius arisanus\n Sequence Length: 1949 amino acids\n Sequence: MAFPFNDQVYTKSFTPREYQVELLYTAKQRDIIICLGKYTEQTFIVTKLIQEFATGNRIPLVSAQRILYLLDSEESCSLKSSYIEQLTDLKVSVIDSTTQDNDFAHIFTSGHVVVTTSAIFYKFV...GRRVRV... |
[
{
"content": "Predict the protein interaction network:\n\nPROTEIN: CG10077\n UniProt ID: Q8MZI3\n Full Name: RNA helicase\n Organism: Drosophila melanogaster\n Sequence Length: 818 amino acids\n Sequence: MNMYNGQMNAFGGGGGGGAGGLAGGMVPNRMGGGAPGGGPGGAGMFQRNRSAPYPGFNGHGPANGGQRRMNGGGPSMGPGGPRNQDGFGGQNGGQRSSNHGA... |
[
{
"content": "Generate a protein network in compressed BioPAX format with the following properties:\n- Proteins: SPAC644.07, SPAP27G11.14c, cbp3, coq7, cyt1, pgr1, ppr1, ppr4, ppr8, sls1\n- Network density: approximately 0.20\n- Hub proteins (highly connected): pgr1, ppr8\n- Total interactions: approximately 9"... |
[
{
"content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.",
"role": "system"
},
{
"content": "Complete this partia... |
[
{
"content": "You are a protein interaction network generator. Given network constraints and properties, generate a biologically plausible protein network in compressed BioPAX format with <proteins> and <interactions> sections.",
"role": "system"
},
{
"content": "Generate a protein network with the ... |
[
{
"content": "Predict the protein interaction network for these proteins:\n\nPROTEIN: NR3C1\n UniProt ID: A1YFI6\n Organism: Saguinus labiatus\n Sequence Length: 50 amino acids\n Sequence: VVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQLPKYSNGNIRKLLFHQK\n AlphaFold Structure: Available\n Structure Coverage: residues 1-... |
[
{
"content": "You are a protein interaction prediction system. Given a list of proteins with their sequence and structural information, predict all likely interactions between them in compressed BioPAX format. Use <proteins> with <p> elements and <interactions> with <i> elements.",
"role": "system"
},
{... |
[
{
"content": "You are a protein interaction network generator. Given network constraints and properties, generate a biologically plausible protein network in compressed BioPAX format with <proteins> and <interactions> sections.",
"role": "system"
},
{
"content": "Generate a protein network with the ... |
[
{
"content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.",
... |
[
{
"content": "Predict the protein interaction network:\n\nPROTEIN: CG10510\n UniProt ID: Q95U04\n Full Name: Dynein regulatory complex subunit 2\n Organism: Drosophila melanogaster\n Sequence Length: 523 amino acids\n Sequence: MAEILARLTRVSENYLQELEEEPEPQGPPKLTKAQKKAAKKEAKRLAMIEEKRLIMRDALMRELEMGKHMEEKGNEEWH... |
[
{
"content": "Known protein network in compressed BioPAX format:\n<biopax>\n <proteins>\n <p id=\"cg11321\" name=\"CG11321\" uniprot=\"A0A0M4ENX1\"/>\n <p id=\"cg12362\" name=\"CG12362\" uniprot=\"Q9VT94\" fullname=\"RBR-type E3 ubiquitin transferase\"/>\n <p id=\"ubcd10\" name=\"UbcD10\" uniprot=\"A0... |
[
{
"content": "Predict the protein interaction network for these proteins in compressed BioPAX format:\n\nPROTEIN: CG13871\n UniProt ID: Q4V5P0\n Organism: Drosophila melanogaster\n Sequence Length: 479 amino acids\n Sequence: PRRPFGSERRDLAPSEQRYFSDPELLFQRLDDMEQKLGIPEKMAAAGKVKSEHYLVGPTNVAAQMLKDNLYKFPIDDGAIGQ... |
[
{
"content": "Generate a protein network with the following properties:\n- Proteins: CG12672, CG17739, CG6656, Cyp28d1, Cyp28d2\n- Network density: approximately 0.50\n- Hub proteins (highly connected): Cyp28d2, Cyp28d1\n- Total interactions: approximately 5",
"role": "user"
},
{
"content": "<biopax... |
[
{
"content": "Known protein network in compressed BioPAX format:\n<biopax>\n <proteins>\n <p id=\"cg10859\" name=\"CG10859\" uniprot=\"A0A0M3QZ12\"/>\n <p id=\"cg3713\" name=\"CG3713\" uniprot=\"Q9V3D7\"/>\n <p id=\"cg8219\" name=\"CG8219\" uniprot=\"Q9VRV9\" fullname=\"Importin N-terminal domain-cont... |
[
{
"content": "You are a protein interaction prediction system. Given a list of proteins with their sequence and structural information, predict all likely interactions between them in compressed BioPAX format. Use <proteins> with <p> elements and <interactions> with <i> elements.",
"role": "system"
},
{... |
[
{
"content": "You are a protein interaction network generator. Given network constraints and properties, generate a biologically plausible protein network in compressed BioPAX format with <proteins> and <interactions> sections.",
"role": "system"
},
{
"content": "Generate a protein network in compre... |
[
{
"content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.",
... |
[
{
"content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.",
"role": "system"
},
{
"content": "Complete this networ... |
[
{
"content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.",
... |
[
{
"content": "Predict the protein interaction network for these proteins:\n\nPROTEIN: CG8177\n UniProt ID: Q1PQ27\n Organism: Drosophila miranda\n Sequence Length: 355 amino acids\n Sequence: RRMPMYKSDILDGLNTETLAATIFMYFACLSTAITFGGLVSDKTKSWIGISETLISCSFVGIVFHCLSCQPLVIIGTTGPLLLFDEALMVFCTQNDFDFLSLRVYVGIWLIIIALC... |
[
{
"content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.",
... |
[
{
"content": "Generate a protein network with the following properties:\n- Proteins: Dg, Mad, Pdp, Su(var)3-9\n- Network density: approximately 0.67\n- Hub proteins (highly connected): Pdp, Mad\n- Total interactions: approximately 4",
"role": "user"
},
{
"content": "<biopax>\n <proteins>\n <p id... |
[
{
"content": "Complete this network:\n<biopax>\n <proteins>\n <p id=\"arnt\" name=\"ARNT\" uniprot=\"Q80T29\"/>\n <p id=\"arnt2\" name=\"ARNT2\" uniprot=\"A0A7K4JWC9\"/>\n <p id=\"arntl\" name=\"ARNTL\" uniprot=\"A0A8K0EMB6\"/>\n <p id=\"maged1\" name=\"MAGED1\" uniprot=\"A0AAU9YY36\"/>\n <p id=... |
[
{
"content": "Generate a protein network with the following properties:\n- Proteins: Akh, AkhR, CCAP, CG11635, CG2865, Crz, Gl\n- Network density: approximately 0.29\n- Hub proteins (highly connected): AkhR, CG11635\n- Total interactions: approximately 6",
"role": "user"
},
{
"content": "<biopax>\n ... |
[
{
"content": "Complete this network:\n<biopax>\n <proteins>\n <p id=\"cg1598\" name=\"CG1598\" uniprot=\"Q6XIF0\"/>\n <p id=\"cg17327\" name=\"CG17327\" uniprot=\"Q6XHQ9\"/>\n <p id=\"cg3097\" name=\"CG3097\" uniprot=\"A0A0M4F8W7\"/>\n <p id=\"cg4820\" name=\"CG4820\" uniprot=\"A0A0M5JC24\"/>\n ... |
[
{
"content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.",
... |
[
{
"content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.",
... |
[
{
"content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.",
... |
[
{
"content": "Generate a protein network in compressed BioPAX format with the following properties:\n- Proteins: CG2224, Mer, Nrx-1, Spn, Tmem173, rictor\n- Network density: approximately 0.53\n- Hub proteins (highly connected): Spn, Nrx-1\n- Total interactions: approximately 8",
"role": "user"
},
{
... |
[
{
"content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.",
... |
[
{
"content": "You are a protein interaction prediction system. Given a list of proteins with their sequence and structural information, predict all likely interactions between them in compressed BioPAX format. Use <proteins> with <p> elements and <interactions> with <i> elements.",
"role": "system"
},
{... |
[
{
"content": "You are a protein interaction prediction system. Given a list of proteins with their sequence and structural information, predict all likely interactions between them in compressed BioPAX format. Use <proteins> with <p> elements and <interactions> with <i> elements.",
"role": "system"
},
{... |
[
{
"content": "Complete this network:\n<biopax>\n <proteins>\n <p id=\"btbd9\" name=\"Btbd9\" uniprot=\"A0A7K4YNQ0\"/>\n <p id=\"cacna1h\" name=\"Cacna1h\" uniprot=\"A0A812NI47\"/>\n <p id=\"dst\" name=\"Dst\" uniprot=\"A0A8J9W0F9\"/>\n <p id=\"faf1\" name=\"Faf1\" uniprot=\"A0A7K8NE75\"/>\n <p i... |
[
{
"content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.",
"role": "system"
},
{
"content": "Complete this networ... |
[
{
"content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.",
"role": "system"
},
{
"content": "Complete this partia... |
[
{
"content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.",
"role": "system"
},
{
"content": "Complete this networ... |
[
{
"content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.",
... |
[
{
"content": "Predict the protein interaction network for these proteins:\n\nPROTEIN: ATbp\n UniProt ID: A0A0M4ES44\n Organism: Drosophila busckii\n Sequence Length: 401 amino acids\n Sequence: MGFPRILSKNNKIYTKLGEFCLSGESFWIVCHTCQEELQTQDAFWKHIQDEHNFLHGVAKQDHSRTSSYCLTDVETATATTGATTAQATGGVTAVSVPLALYHCAAKYSEEEQR... |
[
{
"content": "You are a protein interaction network generator. Given network constraints and properties, generate a biologically plausible protein network in compressed BioPAX format with <proteins> and <interactions> sections.",
"role": "system"
},
{
"content": "Generate a protein network with the ... |
[
{
"content": "You are a protein interaction network generator. Given network constraints and properties, generate a biologically plausible protein network in compressed BioPAX format with <proteins> and <interactions> sections.",
"role": "system"
},
{
"content": "Generate a protein network with the ... |
[
{
"content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.",
... |
[
{
"content": "Predict the protein interaction network:\n\nPROTEIN: Y62E10A.17\n UniProt ID: G2HK15\n Full Name: Transcription factor aptf-2\n Organism: Caenorhabditis elegans\n Sequence Length: 367 amino acids\n Sequence: MDIQMFTTLNSTVPTEPVVGPVEPTVPTVPATKETGPSSSAECSTQPAVAEQEDNSLLAQLLKGKITSDDAKLQPPRGPFEYAPM... |
[
{
"content": "Predict the protein interaction network:\n\nPROTEIN: CG13373\n UniProt ID: A0A0M4EUE9\n Organism: Drosophila busckii\n Sequence Length: 175 amino acids\n Sequence: MESSSNSLKRMRSEDDESNNNVTQTKVWVNEKINNSRDPDKMKAVHEKTTKMLFKAAANMDNRSESEDSAVPVPAAPTLNLCDQYQLIGDGNIILRDLNPDVANPTLERRISACCQRPTLIRGNCVNCTF... |
[
{
"content": "Predict the protein interaction network for these proteins:\n\nPROTEIN: CG32364\n UniProt ID: A0A0M4EYT7\n Organism: Drosophila busckii\n Sequence Length: 230 amino acids\n Sequence: MPSMNFDKKYCTSQINGTVYMTTMKNLSEEQLTKLNAGAGEIYLSNIPKKCSAKRIMQVAVKLGEVYMLRNKIDFLRDSRGFAYLQYINETHMKNTMHALQQLFWNAKLGI... |
[
{
"content": "Predict the protein interaction network:\n\nPROTEIN: CG15308\n UniProt ID: Q9W2X3\n Organism: Drosophila melanogaster\n Sequence Length: 95 amino acids\n Sequence: MKFFIAAFLIAACMALAQCSVIYSPVSSVPVVRSVPVIRSVPVVRSVPVVRRVPVVRRVNVVESVPVVPSVVRVGQAPIYDAPLVQSYGGWLKQK\n AlphaFold Structure: Available\... |
[
{
"content": "You are a protein interaction prediction system. Given a list of proteins with their sequence and structural information, predict all likely interactions between them in compressed BioPAX format. Use <proteins> with <p> elements and <interactions> with <i> elements.",
"role": "system"
},
{... |
[
{
"content": "Known protein network in compressed BioPAX format:\n<biopax>\n <proteins>\n <p id=\"cg15080\" name=\"CG15080\" uniprot=\"A0A0M4EI06\"/>\n <p id=\"cg7158\" name=\"CG7158\" uniprot=\"A0A0M4EN27\"/>\n <p id=\"rab30\" name=\"Rab30\" uniprot=\"Q9VM50\"/>\n <p id=\"sgf11\" name=\"Sgf11\" un... |
[
{
"content": "Predict the protein interaction network for these proteins in compressed BioPAX format:\n\nPROTEIN: asd-2\n UniProt ID: A8XGG9\n Organism: Caenorhabditis briggsae\n Sequence Length: 397 amino acids\n Sequence: MTHASTEHLTPNGSTNGISTSQQQQYSVEYLSQLLKDKKQLAAFPNVFHHLERLADDEISKVRVALFQFEFTKDNVTLPDAEGD... |
[
{
"content": "Complete this partial protein network in compressed BioPAX format:\n<biopax>\n <proteins>\n <p id=\"act-5\" name=\"act-5\" uniprot=\"A8XS95\"/>\n <p id=\"agef-1\" name=\"agef-1\" uniprot=\"A8XWC0\"/>\n <p id=\"elb-1\" name=\"elb-1\" uniprot=\"A8XHD3\"/>\n <p id=\"elc-1\" name=\"elc-1\... |
[
{
"content": "Generate a protein network in compressed BioPAX format with the following properties:\n- Proteins: CG10754, CG18522, CG30324, CG31955, Mst84Dd, Sgt, dar1, hale, kn, nudE\n- Network density: approximately 0.27\n- Hub proteins (highly connected): dar1, hale\n- Total interactions: approximately 12",
... |
[
{
"content": "Generate a protein network in compressed BioPAX format with the following properties:\n- Proteins: CG9593, RpL34b, RpS13, Tequila, mRpL38\n- Network density: approximately 0.40\n- Hub proteins (highly connected): CG9593, RpS13\n- Total interactions: approximately 4",
"role": "user"
},
{
... |
[
{
"content": "Predict the protein interaction network for these proteins in compressed BioPAX format:\n\nPROTEIN: CG2678\n UniProt ID: A0A6I8VZQ2\n Organism: Drosophila pseudoobscura pseudoobscura\n Sequence Length: 329 amino acids\n Sequence: MECVCRVCLDGSVPLVDIFAEISDLRLNLYESSPACVISKLAPEHSVVRGDSMPQFICLSCIHG... |
[
{
"content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.",
... |
[
{
"content": "Predict the protein interaction network:\n\nPROTEIN: C44C10.4\n UniProt ID: Q18616\n Full Name: Structural maintenance of chromosomes-like protein 1\n Organism: Caenorhabditis elegans\n Sequence Length: 537 amino acids\n Sequence: MTYPQQRLLTVDILNFKCYQHHKSFGPFDHVTTFIGMNGCGKSIMIEAIAFVFGEDLPDPKN... |
Dataset Card for BioGRID-Conv
Dataset Description
BioGRID-Conv is a conversational dataset for protein interaction network prediction tasks, derived from the BioGRID 4.4.246 database. The dataset transforms protein interaction data into structured conversation formats suitable for training language models on biological network prediction and completion tasks, enhanced with comprehensive protein sequence and structural information from UniProt and AlphaFold databases.
This dataset was created by Proximile LLC, a company specializing in secure, on-premise AI solutions for small and medium-sized businesses.
Dataset Summary
This dataset contains conversational examples for training models to predict, complete, and analyze protein interaction networks using both interaction data and detailed protein characteristics. Each conversation follows a structured format with system instructions, user queries about protein networks (including sequence and structural context), and detailed network predictions as responses.
The dataset is built from BioGRID 4.4.246, which contains 2,851,050 protein and genetic interactions from 86,799 publications across major model organism species. Each protein is enriched with:
- UniProt sequence data: Protein sequences, functional annotations, organism information
- AlphaFold structural data: 3D structure availability, confidence scores, coverage information
- Integrated biological context: Combining interaction, sequence, and structural information for enhanced predictions
Supported Tasks
- Sequence-Aware Network Prediction: Given proteins with sequence/structure info, predict all likely interactions
- Structure-Guided Network Completion: Complete partial networks using structural compatibility
- New Protein Integration: Predict interactions for new proteins based on sequence similarity and structural features
- Context-Rich Network Generation: Generate networks with detailed protein characteristics and constraints
- Multi-Modal Biological Reasoning: Combine interaction patterns with sequence and structural data
Languages
English (scientific/biological terminology)
Dataset Structure
Data Instances
Each instance contains a conversation with three components, now enhanced with protein sequence and structural context:
{
"updated": [
{
"role": "system",
"content": "You are a protein interaction prediction system. Given a list of proteins with their sequence and structural information, predict all likely interactions between them based on biological knowledge, sequence similarity, and structural compatibility."
},
{
"role": "user",
"content": "Predict the protein interaction network for these proteins:\n\nPROTEIN: CCKLR-17D1\n UniProt ID: P12345\n Full Name: Cholecystokinin-like receptor\n Organism: Drosophila melanogaster\n Sequence Length: 389 amino acids\n Sequence: MSLVLVLLLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLVLV...\n AlphaFold Structure: Available\n Structure Confidence: High\n Function: G-protein coupled receptor involved in...\n\nPROTEIN: CG8507\n UniProt ID: Q67890\n Sequence Length: 256 amino acids\n AlphaFold Structure: Not available\n Function: Putative kinase involved in signal transduction..."
},
{
"role": "assistant",
"content": "PROTEINS: CCKLR-17D1, CG8507, CG9928, Dsk, Ptr\n\nTWO-HYBRID INTERACTIONS:\n CG8507--Dsk\n CG9928--Dsk\n Dsk--Ptr\n\nPHENOTYPIC SUPPRESSION INTERACTIONS:\n CCKLR-17D1--Dsk\n\nNETWORK SUMMARY: 5 proteins, 4 interactions\n\nPROTEIN DETAILS:\n CCKLR-17D1 | 389aa | AlphaFold(High) | Drosophila\n CG8507 | 256aa | Drosophila\n CG9928 | 198aa | AlphaFold(Medium) | Drosophila\n Dsk | 445aa | AlphaFold(High) | Drosophila\n Ptr | 312aa | AlphaFold(Low) | Drosophila"
}
]
}
Data Fields
- role: String indicating the conversation participant ("system", "user", "assistant")
- content: String containing the message content
- System messages define the task type and model behavior, emphasizing sequence/structure integration
- User messages contain protein lists with detailed biological context, partial networks, or generation constraints
- Assistant messages contain structured network predictions with protein summaries
Enhanced Network Format
Networks are represented in a standardized text format with integrated protein information:
PROTEINS: [comma-separated list]
[INTERACTION_TYPE] INTERACTIONS:
protein1--protein2
protein3--protein4
NETWORK SUMMARY: X proteins, Y interactions
PROTEIN DETAILS:
protein1 | [length]aa | AlphaFold([confidence]) | [organism]
protein2 | [length]aa | [organism]
Protein Enrichment Details
Each protein includes when available:
- UniProt ID and cross-references
- Complete amino acid sequences (truncated for display)
- Sequence lengths and composition
- AlphaFold structure availability and confidence scores
- Functional annotations and GO terms
- Organism and taxonomic information
- Structural coverage and model quality metrics
Interaction types include:
- TWO-HYBRID INTERACTIONS
- AFFINITY CAPTURE-MS INTERACTIONS
- AFFINITY CAPTURE-WESTERN INTERACTIONS
- PHENOTYPIC ENHANCEMENT/SUPPRESSION INTERACTIONS
- CO-FRACTIONATION INTERACTIONS
- BIOCHEMICAL ACTIVITY INTERACTIONS
- And others from BioGRID evidence codes
Dataset Creation
Source Data
The dataset is derived from multiple high-quality biological databases:
- BioGRID 4.4.246: Comprehensive database of protein, genetic and chemical interactions curated from biomedical literature
- UniProt: Protein sequence database providing functional annotations, sequences, and cross-references
- AlphaFold: AI-predicted protein structure database from DeepMind/EMBL-EBI
Data Processing Pipeline
The enhanced dataset creation process includes:
BioGRID Processing: Neighborhood extraction around high-degree proteins (3-15 connections) to create manageable training examples
Protein Data Enrichment:
- UniProt API Integration: Fetch protein sequences, functional annotations, organism information
- AlphaFold API Integration: Retrieve structure availability, confidence scores, coverage data
- Thread-Safe Caching: Persistent file-based caching with file locking to prevent data corruption during parallel processing
- Multiprocessing: Parallel enrichment of protein data with automatic cache management
Enhanced Conversation Generation: Four types of conversational tasks generated from each neighborhood:
- Complete network prediction from protein lists with sequence context
- New protein integration using sequence similarity and structural compatibility
- Partial network completion with structural guidance
- Property-constrained network generation with biological context
Format Standardization: All interactions and protein data converted to consistent text representation with standardized naming and comprehensive biological context
Processing Performance
- Multiprocessing: Utilizes all available CPU cores for parallel processing of neighborhoods, protein enrichment, and conversation generation
- Intelligent Caching: Thread-safe persistent caching reduces API calls by >90% on subsequent runs
- Scalable Architecture: Configurable protein processing limits (default: 5,000 proteins) for memory management
- Batch Processing: Efficient batching of API requests with rate limiting to respect service limits
Data Splits
The dataset contains conversations generated from protein neighborhoods, randomly shuffled. Users should create their own train/validation/test splits as needed for their specific use case.
Considerations for Using the Data
Recommended Use Cases
- Training language models for sequence-aware biological network prediction
- Fine-tuning protein interaction prediction systems with structural context
- Developing conversation agents for integrated bioinformatics analysis
- Benchmarking multi-modal network completion algorithms
- Educational tools combining protein structure, sequence, and interaction analysis
- Research in protein function prediction using multiple data modalities
Enhanced Capabilities
- Multi-Modal Learning: Combines interaction patterns with sequence and structural information
- Biological Realism: Predictions grounded in actual protein characteristics rather than just names
- Structural Awareness: Integration of AlphaFold confidence scores for structure-guided predictions
- Functional Context: UniProt functional annotations provide biological reasoning for interactions
- Scalable Processing: Efficient parallel processing with persistent caching for large-scale analysis
Limitations
- Coverage: Limited to proteins present in BioGRID 4.4.246, UniProt, and AlphaFold databases
- API Dependencies: Protein enrichment requires internet access for initial data fetching (cached thereafter)
- Bias: May reflect publication bias in biomedical literature and structural prediction limitations
- Static Data: Represents knowledge as of BioGRID 4.4.246 (June 2025) and doesn't include more recent discoveries
- Structure Quality: AlphaFold predictions vary in confidence; low-confidence regions may affect structure-based predictions
- Processing Time: Initial dataset generation with protein enrichment requires significant computational time
Ethical Considerations
- Data derived from publicly available scientific literature and databases
- No personal or sensitive information included
- Should be used to advance scientific understanding of biological systems
- Results should be validated experimentally before clinical or therapeutic applications
Additional Information
Licensing
The dataset inherits licensing from source databases:
- BioGRID: Free for academic and non-commercial use
- UniProt: Creative Commons Attribution (CC BY 4.0) License
- AlphaFold: Creative Commons Attribution (CC BY 4.0) License
Commercial users should review individual database terms of use.
Dataset Files
The dataset generation produces multiple output files:
processed_dataset.json: Main conversational datasetprocessed_dataset_protein_data.json: Enriched protein information for referenceprotein_cache/: Directory containing cached API responses for efficient reprocessing
Citation
@misc{biogrid-conv-2025,
title={BioGRID-Conv: A Conversational Dataset for Protein Interaction Network Prediction with Sequence and Structural Context},
author={Proximile LLC},
year={2025},
url={https://huggingface.co/datasets/Proximile/BioGRID-Conv}
}
@article{biogrid2023,
title={The BioGRID database: A comprehensive biomedical resource of curated protein, genetic, and chemical interactions},
journal={Protein Science},
year={2023},
publisher={Wiley Online Library}
}
@article{uniprot2023,
title={UniProt: the Universal Protein Knowledgebase in 2023},
journal={Nucleic Acids Research},
year={2023}
}
@article{alphafold2021,
title={Highly accurate protein structure prediction with AlphaFold},
journal={Nature},
year={2021}
}
Technical Specifications
- Python Dependencies: pandas, numpy, networkx, requests, multiprocessing
- API Integration: UniProt REST API, AlphaFold API
- Caching System: Thread-safe file-based caching with fcntl locking
- Parallel Processing: Multiprocessing with configurable worker counts
- Memory Management: Batched processing with configurable limits
Dataset Version
Version 2.0 based on BioGRID 4.4.246 with integrated UniProt and AlphaFold data enrichment
Contact
For questions about this dataset, please refer to the HuggingFace dataset repository, visit proximile.llc, or consult the original database documentation.
About Proximile LLC
Proximile LLC provides secure, cost-effective, and private AI solutions tailored to small and medium-sized businesses. We specialize in:
- On-premise AI inference solutions that ensure unparalleled privacy
- Cost-effective hardware configurations including specialized AI hardware setups
- Secure Local AI applications including chatbots, RAG systems, and custom AI tools
- Specialized services for compliance & governance, knowledge management, and IT automation
- Bioinformatics AI Solutions for research institutions and biotechnology companies
Visit proximile.llc to learn more about our secure, local AI solutions for your business and research needs.
Funding
Original BioGRID data curation supported by the National Institutes of Health, Canadian Institutes of Health Research, and other funding bodies listed on the BioGRID website. UniProt supported by the National Institutes of Health and European Molecular Biology Laboratory. AlphaFold developed by DeepMind in partnership with EMBL-EBI. Dataset creation and curation by Proximile LLC.
- Downloads last month
- 4