name string | repo dict | requires string | papers sequence | category string | description string | arguments list | returns list | example dict | test_invocations list | note string | python_signature string | xml_summary string | papers_info list |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
abrsp_vote_predictor | {
"branch": null,
"commit": "8ba3a7c",
"env": [],
"info": "ABRS-P from https://github.com/qinghezeng/ABRS-P (at commit: 8ba3a7c)",
"name": "ABRS-P",
"url": "https://github.com/qinghezeng/ABRS-P"
} | cuda | [
"zeng2023abrsp"
] | pathology | Predict binary sensitivity (High vs Low) to atezolizumab-bevacizumab with the 10-fold ABRS-P model: for each sample keep the ordered list of ten raw scores, apply the matching thresholds, count “High” votes, and assign High if ≥ 5, else Low (ties impossible). | [
{
"description": "CSV that was used to train the checkpoints, listing every slide/patient to evaluate; must include `slide_id` and the column named by `label_col` (values are loaded but not used for prediction).",
"name": "dataset_csv_file",
"type": "str"
},
{
"description": "Name of the express... | [
{
"description": "List of dictionaries mirroring the rows of the output CSV (`sample_id`, `fold_0` … `fold_9`, `final`).",
"name": "predictions",
"type": "list"
}
] | {
"arguments": [
{
"name": "dataset_csv_file",
"value": "\"/mount/input/dataset_csv/myscore_s1.csv\""
},
{
"name": "label_col",
"value": "\"my_score\""
},
{
"name": "dataset_splits_dir",
"value": "\"/mount/input/dataset_splits/s1_100\""
},
{
"name"... | [
{
"arguments": [
{
"name": "dataset_csv_file",
"value": "\"/mount/input/dataset_csv/myscore_s2.csv\""
},
{
"name": "label_col",
"value": "\"my_score\""
},
{
"name": "dataset_splits_dir",
"value": "\"/mount/input/dataset_splits/s2_100\... | null | def abrsp_vote_predictor(dataset_csv_file: str = '/mount/input/dataset_csv/myscore_s1.csv', label_col: str = 'my_score', dataset_splits_dir: str = '/mount/input/dataset_splits/s1_100', checkpoints_dir: str = '/mount/input/10_fold_checkpoints', features_dir: str = '/mount/input/TCGA-LIHC-cTransPath-features-20x', fixed_... | <description>
Predict binary sensitivity (High vs Low) to atezolizumab-bevacizumab with the 10-fold ABRS-P model: for each sample keep the ordered list of ten raw scores, apply the matching thresholds, count “High” votes, and assign High if ≥ 5, else Low (ties impossible).
</description>
<arguments>
dataset_csv_file (s... | [
{
"bibtex": "@article{zeng2023abrsp,\n author = {Zeng, Qinghe\n and Klein, Christophe\n and Caruso, Stefano\n and Maille, Pascale\n and Allende, Daniela S.\n and M{\\'i}nguez, Beatriz\n and Iavarone, Massimo\n ... |
cobra_extract_features | {
"branch": null,
"commit": null,
"env": [
{
"name": "HF_TOKEN",
"value": "${env:HF_TOKEN}"
}
],
"info": "COBRA from https://github.com/KatherLab/COBRA",
"name": "COBRA",
"url": "https://github.com/KatherLab/COBRA"
} | cuda | [
"lenz2025cobra"
] | pathology | Perform feature extraction on an input image using COBRA. The provided tile features have 1.0 mpp (224 microns / 224 px per patch). | [
{
"description": "Path to the output folder where the features will be saved",
"name": "output_dir",
"type": "str"
},
{
"description": "Path to the input folder containing the tile features",
"name": "input_dir",
"type": "str"
}
] | [
{
"description": "The number of slides that were processed",
"name": "num_processed_slides",
"type": "int"
}
] | {
"arguments": [
{
"name": "output_dir",
"value": "\"/mount/output/cobra_features-brca-single\""
},
{
"name": "input_dir",
"value": "\"/mount/input/TCGA-BRCA-Virchow2-features-10x/\""
}
],
"mount": [
{
"source": "TCGA-BRCA-Virchow2-features-10x/TCGA-BH-A0HQ-01Z-00... | [
{
"arguments": [
{
"name": "output_dir",
"value": "\"/mount/output/cobra_features-crc\""
},
{
"name": "input_dir",
"value": "\"/mount/input/TCGA-CRC-Virchow2-features-10x\""
}
],
"mount": [
{
"source": "TCGA-CRC-Virchow2-features-10x"... | null | def cobra_extract_features(output_dir: str = '/mount/output/cobra_features-brca-single', input_dir: str = '/mount/input/TCGA-BRCA-Virchow2-features-10x/') -> dict:
"""
Perform feature extraction on an input image using COBRA. The provided tile features have 1.0 mpp (224 microns / 224 px per patch).
Arg... | <description>
Perform feature extraction on an input image using COBRA. The provided tile features have 1.0 mpp (224 microns / 224 px per patch).
</description>
<arguments>
output_dir (str): Path to the output folder where the features will be saved (example: '/mount/output/cobra_features-brca-single')
input_dir (str):... | [
{
"bibtex": "@inproceedings{lenz2025cobra,\n author = {T. Lenz* and Peter Neidlinger* and Marta Ligero and Georg Wölflein and Marko van Treeck and Jakob Nikolas Kather},\n title = {Unsupervised Foundation Model-Agnostic Slide-Level Representation Learning},\n year = {2025},\n booktitle = {Procee... |
cobra_heatmaps | {
"branch": null,
"commit": null,
"env": [
{
"name": "HF_TOKEN",
"value": "${env:HF_TOKEN}"
}
],
"info": "COBRA from https://github.com/KatherLab/COBRA",
"name": "COBRA",
"url": "https://github.com/KatherLab/COBRA"
} | cuda | [
"lenz2025cobra"
] | pathology | Create unsupervised heatmaps using COBRA. The provided tile features have 1.0 mpp (224 microns / 224 px per patch). | [
{
"description": "Path to the output folder where the features will be saved",
"name": "output_dir",
"type": "str"
},
{
"description": "Path to the input folder containing the WSIs",
"name": "slide_dir",
"type": "str"
},
{
"description": "Path to the input folder containing the t... | [
{
"description": "The number of heatmaps that were generated",
"name": "num_heatmaps",
"type": "int"
},
{
"description": "The number of total bytes of the generated heatmaps",
"name": "byte_size_heatmaps",
"type": "int"
}
] | {
"arguments": [
{
"name": "output_dir",
"value": "\"/mount/output/cobra_heatmaps-crc\""
},
{
"name": "tile_features_dir",
"value": "\"/mount/input/TCGA-CRC-Virchow2-features-10x\""
},
{
"name": "slide_dir",
"value": "\"/mount/input/crc-wsi\""
}
],
"moun... | [
{
"arguments": [
{
"name": "output_dir",
"value": "\"/mount/output/cobra_heatmaps-crc\""
},
{
"name": "tile_features_dir",
"value": "\"/mount/input/TCGA-CRC-Virchow2-features-10x\""
},
{
"name": "slide_dir",
"value": "\"/mount/input/c... | null | def cobra_heatmaps(output_dir: str = '/mount/output/cobra_heatmaps-crc', slide_dir: str = '/mount/input/crc-wsi', tile_features_dir: str = '/mount/input/TCGA-CRC-Virchow2-features-10x') -> dict:
"""
Create unsupervised heatmaps using COBRA. The provided tile features have 1.0 mpp (224 microns / 224 px per patch... | <description>
Create unsupervised heatmaps using COBRA. The provided tile features have 1.0 mpp (224 microns / 224 px per patch).
</description>
<arguments>
output_dir (str): Path to the output folder where the features will be saved (example: '/mount/output/cobra_heatmaps-crc')
slide_dir (str): Path to the input folde... | [
{
"bibtex": "@inproceedings{lenz2025cobra,\n author = {T. Lenz* and Peter Neidlinger* and Marta Ligero and Georg Wölflein and Marko van Treeck and Jakob Nikolas Kather},\n title = {Unsupervised Foundation Model-Agnostic Slide-Level Representation Learning},\n year = {2025},\n booktitle = {Procee... |
conch_extract_features | {
"branch": null,
"commit": "171f2be",
"env": [
{
"name": "HF_TOKEN",
"value": "${env:HF_TOKEN}"
}
],
"info": "CONCH from https://github.com/mahmoodlab/CONCH (at commit: 171f2be)",
"name": "CONCH",
"url": "https://github.com/mahmoodlab/CONCH"
} | cuda | [
"lu2024conch"
] | pathology | Perform feature extraction on an input image using CONCH. | [
{
"description": "Path to the input image",
"name": "input_image",
"type": "str"
}
] | [
{
"description": "The feature vector extracted from the input image, as a list of floats",
"name": "features",
"type": "list"
}
] | {
"arguments": [
{
"name": "input_image",
"value": "\"/mount/input/TUM-TCGA-ACRLPPQE.tif\""
}
],
"mount": [
{
"source": "TUM-TCGA-ACRLPPQE.tif",
"target": "TUM-TCGA-ACRLPPQE.tif"
}
],
"name": "example"
} | [
{
"arguments": [
{
"name": "input_image",
"value": "\"/mount/input/MUC/MUC-TCGA-ACCPKIPN.tif\""
}
],
"mount": [
{
"source": "MUC-TCGA-ACCPKIPN.tif",
"target": "MUC/MUC-TCGA-ACCPKIPN.tif"
}
],
"name": "tif"
},
{
"arguments": [
... | null | def conch_extract_features(input_image: str = '/mount/input/TUM-TCGA-ACRLPPQE.tif') -> dict:
"""
Perform feature extraction on an input image using CONCH.
Args:
input_image: Path to the input image
Returns:
dict with the following structure:
{
'features': list... | <description>
Perform feature extraction on an input image using CONCH.
</description>
<arguments>
input_image (str): Path to the input image (example: '/mount/input/TUM-TCGA-ACRLPPQE.tif')
</arguments>
<returns>
dict with the following structure:
{
'features': list # The feature vector extracted from the input imag... | [
{
"bibtex": "@article{lu2024conch,\n author = {Lu, Ming Y. and Chen, Bowen and Williamson, Drew F. K. and Chen, Richard J. and Liang, Ivy and Ding, Tong and Jaume, Guillaume and Odintsov, Igor and Le, Long Phi and Gerber, Georg and Parwani, Anil V. and Zhang, Andrew and Mahmood, Faisal},\n tit... |
cytopus_db | {
"branch": null,
"commit": "638dd91",
"env": [],
"info": "Cytopus from https://github.com/wallet-maker/cytopus (at commit: 638dd91)",
"name": "Cytopus",
"url": "https://github.com/wallet-maker/cytopus"
} | cpu | [
"kunes2023cytopus"
] | genomics_proteomics | Initialize the Cytopus KnowledgeBase and generate a JSON file containing a nested dictionary with gene set annotations organized by cell type, suitable for input into the Spectra library. | [
{
"description": "List of cell types for which to retrieve gene sets",
"name": "celltype_of_interest",
"type": "list"
},
{
"description": "List of global cell types to include in the JSON file.",
"name": "global_celltypes",
"type": "list"
},
{
"description": "Path to the file whe... | [
{
"description": "The list of keys in the produced JSON file.",
"name": "keys",
"type": "list"
}
] | {
"arguments": [
{
"name": "celltype_of_interest",
"value": "[\"B_memory\", \"B_naive\", \"CD4_T\", \"CD8_T\", \"DC\", \"ILC3\", \"MDC\", \"NK\", \"Treg\", \"gdT\", \"mast\", \"pDC\", \"plasma\"]"
},
{
"name": "global_celltypes",
"value": "[\"all-cells\", \"leukocyte\"]"
},
... | [
{
"arguments": [
{
"name": "celltype_of_interest",
"value": "[\"B\", \"CD4_T\"]"
},
{
"name": "global_celltypes",
"value": "[\"all-cells\", \"leukocyte\"]"
},
{
"name": "output_file",
"value": "\"/mount/output/Spectra_dict.json\""
... | The information on how to do this is in: https://github.com/wallet-maker/cytopus/blob/main/notebooks/KnowledgeBase_queries_colaboratory.ipynb
| def cytopus_db(celltype_of_interest: list = ['B_memory', 'B_naive', 'CD4_T', 'CD8_T', 'DC', 'ILC3', 'MDC', 'NK', 'Treg', 'gdT', 'mast', 'pDC', 'plasma'], global_celltypes: list = ['all-cells', 'leukocyte'], output_file: str = '/mount/output/Spectra_dict.json') -> dict:
"""
Initialize the Cytopus KnowledgeBase a... | <description>
Initialize the Cytopus KnowledgeBase and generate a JSON file containing a nested dictionary with gene set annotations organized by cell type, suitable for input into the Spectra library.
</description>
<arguments>
celltype_of_interest (list): List of cell types for which to retrieve gene sets (example: [... | [
{
"bibtex": "@article{kunes2023cytopus,\n author = {Kunes, Russell Z. and Walle, Thomas and Land, Max and Nawy, Tal and Pe’er, Dana},\n title = {Supervised discovery of interpretable gene programs from single-cell data},\n year = {2023},\n journal = {Nature Biotechnology},\n volume = ... |
cyvcf2_count_alterations | {
"branch": "main",
"commit": "541ab16",
"env": [],
"info": "cyvcf2 from https://github.com/brentp/cyvcf2 (at commit: 541ab16) (at branch: main)",
"name": "cyvcf2",
"url": "https://github.com/brentp/cyvcf2"
} | cpu | [
"pedersen2017cyvcf2"
] | genomics_proteomics | Use cyvcf2 to parse through VCF file containing detected sequence variants to identify the number of single nucleotide polymorphisms (SNPs) from a specific reference nucleotide to a specific alternate nucleotide. | [
{
"description": "Path to the input VCF file",
"name": "input_vcf",
"type": "str"
},
{
"description": "The reference nucleotide to compare against (\"A\", \"C\", \"G\", or \"T\")",
"name": "reference_nucleotide",
"type": "str"
},
{
"description": "The alternate nucleotide to comp... | [
{
"description": "The number of SNPs that are altered from reference `reference_nucleotide` to `alternate_nucleotide`.",
"name": "num_snps",
"type": "int"
}
] | {
"arguments": [
{
"name": "input_vcf",
"value": "\"/mount/input/SRR2058984_zc.vcf\""
},
{
"name": "reference_nucleotide",
"value": "\"A\""
},
{
"name": "alternate_nucleotide",
"value": "\"C\""
}
],
"mount": [
{
"source": "SRR2058984_zc.vcf",
... | [
{
"arguments": [
{
"name": "input_vcf",
"value": "\"/mount/input/SRR2058985_zc.vcf\""
},
{
"name": "reference_nucleotide",
"value": "\"A\""
},
{
"name": "alternate_nucleotide",
"value": "\"T\""
}
],
"mount": [
{
... | null | def cyvcf2_count_alterations(input_vcf: str = '/mount/input/SRR2058984_zc.vcf', reference_nucleotide: str = 'A', alternate_nucleotide: str = 'C') -> dict:
"""
Use cyvcf2 to parse through VCF file containing detected sequence variants to identify the number of single nucleotide polymorphisms (SNPs) from a specif... | <description>
Use cyvcf2 to parse through VCF file containing detected sequence variants to identify the number of single nucleotide polymorphisms (SNPs) from a specific reference nucleotide to a specific alternate nucleotide.
</description>
<arguments>
input_vcf (str): Path to the input VCF file (example: '/mount/inpu... | [
{
"bibtex": "@article{pedersen2017cyvcf2,\n author = {Pedersen, Brent S and Quinlan, Aaron R},\n title = {cyvcf2: fast, flexible variant analysis with Python},\n year = {2017},\n month = {02},\n journal = {Bioinformatics},\n volume = {33},\n number = {12},\n pages = {1867-1869},\n issn =... |
eagle_extract_features | {
"branch": "simple_feature_extraction",
"commit": null,
"env": [],
"info": "EAGLE from https://github.com/KatherLab/EAGLE (at branch: simple_feature_extraction)",
"name": "EAGLE",
"url": "https://github.com/KatherLab/EAGLE"
} | cuda | [
"neidlinger2025eagle"
] | pathology | Perform slide-level feature extraction using EAGLE, given tile-level features. | [
{
"description": "Path to the output folder where the features will be saved",
"name": "output_dir",
"type": "str"
},
{
"description": "Path to the input folder containing the tile features to create the weighting (chief-CTP). Files are in *.h5 format, one file per slide.",
"name": "feature_... | [
{
"description": "The number of slides that were processed",
"name": "num_processed_slides",
"type": "int"
}
] | {
"arguments": [
{
"name": "output_dir",
"value": "\"/mount/output/cobra_features-crc\""
},
{
"name": "feature_dir_aggregation",
"value": "\"/mount/input/TCGA-CRC-Virchow2-features\""
},
{
"name": "feature_dir_weighting",
"value": "\"/mount/input/TCGA-CRC-ChiefC... | [
{
"arguments": [
{
"name": "output_dir",
"value": "\"/mount/output/cobra_features-crc\""
},
{
"name": "feature_dir_aggregation",
"value": "\"/mount/input/TCGA-CRC-Virchow2-features\""
},
{
"name": "feature_dir_weighting",
"value": "\"... | null | def eagle_extract_features(output_dir: str = '/mount/output/cobra_features-crc', feature_dir_weighting: str = '/mount/input/TCGA-CRC-ChiefCTP-features', feature_dir_aggregation: str = '/mount/input/TCGA-CRC-Virchow2-features') -> dict:
"""
Perform slide-level feature extraction using EAGLE, given tile-level fea... | <description>
Perform slide-level feature extraction using EAGLE, given tile-level features.
</description>
<arguments>
output_dir (str): Path to the output folder where the features will be saved (example: '/mount/output/cobra_features-crc')
feature_dir_weighting (str): Path to the input folder containing the tile fea... | [
{
"bibtex": "@misc{neidlinger2025eagle,\n author = {Peter Neidlinger and Tim Lenz and Sebastian Foersch and Chiara M. L. Loeffler and Jan Clusmann and Marco Gustav and Lawrence A. Shaktah and Rupert Langer and Bastian Dislich and Lisa A. Boardman and Amy J. French and Ellen L. Goode and Andrea Gsur and ... |
esm_fold_predict | {
"branch": null,
"commit": "2b36991",
"env": [],
"info": "ESM from https://github.com/facebookresearch/esm (at commit: 2b36991)",
"name": "ESM",
"url": "https://github.com/facebookresearch/esm"
} | cuda | [
"verkuil2022esm1",
"hie2022esm2"
] | genomics_proteomics | Generate the representation of a protein sequence and the contact map using Facebook Research's pretrained esm2_t33_650M_UR50D model. | [
{
"description": "Protein sequence to for which to generate representation and contact map.",
"name": "sequence",
"type": "str"
}
] | [
{
"description": "Token representations for the protein sequence as a list of floats, i.e. a 1D array of shape L where L is the number of tokens.",
"name": "sequence_representation",
"type": "list"
},
{
"description": "Contact map for the protein sequence as a list of list of floats, i.e. a 2D a... | {
"arguments": [
{
"name": "sequence",
"value": "\"MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG\""
}
],
"mount": [],
"name": "example"
} | [
{
"arguments": [
{
"name": "sequence",
"value": "\"KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE\""
}
],
"mount": [],
"name": "protein2"
},
{
"arguments": [
{
"name": "sequence",
"value": "\"KALTARQQEVFDLIRD<mask>ISQ... | This repository does not contain any simple CLI functions, but examples. We ask the model to re-implement one of the examples. | def esm_fold_predict(sequence: str = 'MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG') -> dict:
"""
Generate the representation of a protein sequence and the contact map using Facebook Research's pretrained esm2_t33_650M_UR50D model.
Args:
sequence: Protein sequence to for wh... | <description>
Generate the representation of a protein sequence and the contact map using Facebook Research's pretrained esm2_t33_650M_UR50D model.
</description>
<arguments>
sequence (str): Protein sequence to for which to generate representation and contact map. (example: 'MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIA... | [
{
"bibtex": "@misc{verkuil2022esm1,\n author = {Verkuil, Robert and Kabeli, Ori and Du, Yilun and Wicky, Basile I. M. and Milles, Lukas F. and Dauparas, Justas and Baker, David and Ovchinnikov, Sergey and Sercu, Tom and Rives, Alexander},\n title = {Language models generalize beyond natural pro... |
flowmap_overfit_scene | {
"branch": null,
"commit": "578a515",
"env": [],
"info": "FlowMap from https://github.com/dcharatan/flowmap (at commit: 578a515)",
"name": "FlowMap",
"url": "https://github.com/dcharatan/flowmap"
} | cuda | [
"smith2024flowmap"
] | misc | Overfit FlowMap on an input scene to determine camera extrinsics for each frame in the scene. | [
{
"description": "Path to the directory containing the images of the input scene (just the image files, nothing else)",
"name": "input_scene",
"type": "str"
}
] | [
{
"description": "The number of images (frames) in the scene",
"name": "n",
"type": "int"
},
{
"description": "The camera extrinsics matrix for each of the n frames in the scene, must have a shape of nx4x4 (as a nested python list of floats)",
"name": "camera_extrinsics",
"type": "list"
... | {
"arguments": [
{
"name": "input_scene",
"value": "\"/mount/input/llff_flower\""
}
],
"mount": [
{
"source": "flowmap/llff_flower",
"target": "llff_flower"
}
],
"name": "example"
} | [
{
"arguments": [
{
"name": "input_scene",
"value": "\"/mount/input/llff_fern\""
}
],
"mount": [
{
"source": "flowmap/llff_fern",
"target": "llff_fern"
}
],
"name": "llff_fern"
},
{
"arguments": [
{
"name": "input_scene... | null | def flowmap_overfit_scene(input_scene: str = '/mount/input/llff_flower') -> dict:
"""
Overfit FlowMap on an input scene to determine camera extrinsics for each frame in the scene.
Args:
input_scene: Path to the directory containing the images of the input scene (just the image files, nothing el... | <description>
Overfit FlowMap on an input scene to determine camera extrinsics for each frame in the scene.
</description>
<arguments>
input_scene (str): Path to the directory containing the images of the input scene (just the image files, nothing else) (example: '/mount/input/llff_flower')
</arguments>
<returns>
dict ... | [
{
"bibtex": "@misc{smith2024flowmap,\n author = {Cameron Smith and David Charatan and Ayush Tewari and Vincent Sitzmann},\n title = {FlowMap: High-Quality Camera Poses, Intrinsics, and Depth via Gradient Descent},\n year = {2024},\n archiveprefix = {arXiv},\n eprint = {2404.1... |
llmaix_extract_text | {
"branch": null,
"commit": "693564b",
"env": [],
"info": "LLMAIx from https://github.com/KatherLab/LLMAIx (at commit: 693564b)",
"name": "LLMAIx",
"url": "https://github.com/KatherLab/LLMAIx"
} | cpu | [
"wiest2024llm"
] | llms | Preprocess various input files into a standardized structure - a list of the texts. The list can contain multiple texts in case of .csv and .xlsx input files. In some cases, OCR needs to be applied or even enforced to get the correct text from a pdf (or image) document. | [
{
"description": "Path to the input file. Input file can be a .pdf, .csv, .xlsx, .png, .jpg and .docx file.",
"name": "file_path",
"type": "str"
}
] | [
{
"description": "The preprocessed document(s), as a list of strings (usually only one string, but in case .csv or .xlsx documents are preprocessed - one per line).",
"name": "ocr_text_list",
"type": "list"
}
] | {
"arguments": [
{
"name": "file_path",
"value": "\"/mount/input/9874563.pdf\""
}
],
"mount": [
{
"source": "9874563.pdf",
"target": "9874563.pdf"
}
],
"name": "example"
} | [
{
"arguments": [
{
"name": "file_path",
"value": "\"/mount/input/9874563.pdf\""
}
],
"mount": [
{
"source": "9874563.pdf",
"target": "9874563.pdf"
}
],
"name": "pdf_ocr"
},
{
"arguments": [
{
"name": "file_path",
... | null | def llmaix_extract_text(file_path: str = '/mount/input/9874563.pdf') -> dict:
"""
Preprocess various input files into a standardized structure - a list of the texts. The list can contain multiple texts in case of .csv and .xlsx input files. In some cases, OCR needs to be applied or even enforced to get the corr... | <description>
Preprocess various input files into a standardized structure - a list of the texts. The list can contain multiple texts in case of .csv and .xlsx input files. In some cases, OCR needs to be applied or even enforced to get the correct text from a pdf (or image) document.
</description>
<arguments>
file_pat... | [
{
"bibtex": "@article{wiest2024llm,\n author = {Wiest, Isabella Catharina and Wolf, Fabian and Le{\\ss}mann, Marie-Elisabeth and van Treeck, Marko and Ferber, Dyke and Zhu, Jiefu and Boehme, Heiko and Bressem, Keno K and Ulrich, Hannes and Ebert, Matthias P and others},\n title = {LLM-AIx: An open source p... |
medsam_inference | {
"branch": null,
"commit": "b9db486",
"env": [],
"info": "MedSAM from https://github.com/bowang-lab/MedSAM (at commit: b9db486)",
"name": "MedSAM",
"url": "https://github.com/bowang-lab/MedSAM"
} | cuda | [
"ma2024medsam"
] | radiology | Use the trained MedSAM model to segment the given abdomen CT scan. | [
{
"description": "Path to the abdomen CT scan image.",
"name": "image_file",
"type": "str"
},
{
"description": "Bounding box to segment (list of 4 integers).",
"name": "bounding_box",
"type": "list"
},
{
"description": "Path to where the segmentation image should be saved.",
... | [] | {
"arguments": [
{
"name": "image_file",
"value": "\"/mount/input/my_image.jpg\""
},
{
"name": "bounding_box",
"value": "[25, 100, 155, 155]"
},
{
"name": "segmentation_file",
"value": "\"/mount/output/segmented_image.png\""
}
],
"mount": [
{
"... | [
{
"arguments": [
{
"name": "image_file",
"value": "\"/mount/input/cucumber.jpg\""
},
{
"name": "bounding_box",
"value": "[25, 100, 155, 155]"
},
{
"name": "segmentation_file",
"value": "\"/mount/output/segmented_image.png\""
}
... | null | def medsam_inference(image_file: str = '/mount/input/my_image.jpg', bounding_box: list = [25, 100, 155, 155], segmentation_file: str = '/mount/output/segmented_image.png') -> dict:
"""
Use the trained MedSAM model to segment the given abdomen CT scan.
Args:
image_file: Path to the abdomen CT sc... | <description>
Use the trained MedSAM model to segment the given abdomen CT scan.
</description>
<arguments>
image_file (str): Path to the abdomen CT scan image. (example: '/mount/input/my_image.jpg')
bounding_box (list): Bounding box to segment (list of 4 integers). (example: [25, 100, 155, 155])
segmentation_file (str... | [
{
"bibtex": "@article{ma2024medsam,\n author = {Ma, Jun and He, Yuting and Li, Feifei and Han, Lin and You, Chenyu and Wang, Bo},\n title = {Segment anything in medical images},\n year = {2024},\n journal = {Nature Communications},\n volume = {15},\n number = {1},\n publisher = ... |
medsss_generate | {
"branch": null,
"commit": "ebbfd02",
"env": [
{
"name": "HF_TOKEN",
"value": "${env:HF_TOKEN}"
}
],
"info": "MedSSS from https://github.com/pixas/MedSSS (at commit: ebbfd02)",
"name": "MedSSS",
"url": "https://github.com/pixas/MedSSS"
} | cuda | [
"jiang2025medsss"
] | llms | Given a user message, generate a response using the MedSSS_Policy model. | [
{
"description": "The user message.",
"name": "user_message",
"type": "str"
}
] | [
{
"description": "The response generated by the model.",
"name": "response",
"type": "str"
}
] | {
"arguments": [
{
"name": "user_message",
"value": "\"How to stop a cough?\""
}
],
"mount": [],
"name": "example"
} | [
{
"arguments": [
{
"name": "user_message",
"value": "\"How would you treat a patient with advanced non-small cell lung cancer?\""
}
],
"mount": [],
"name": "nsclc"
},
{
"arguments": [
{
"name": "user_message",
"value": "\"You are the first re... | null | def medsss_generate(user_message: str = 'How to stop a cough?') -> dict:
"""
Given a user message, generate a response using the MedSSS_Policy model.
Args:
user_message: The user message.
Returns:
dict with the following structure:
{
'response': str # The res... | <description>
Given a user message, generate a response using the MedSSS_Policy model.
</description>
<arguments>
user_message (str): The user message. (example: 'How to stop a cough?')
</arguments>
<returns>
dict with the following structure:
{
'response': str # The response generated by the model.
}
</returns> | [
{
"bibtex": "@misc{jiang2025medsss,\n author = {Shuyang Jiang and Yusheng Liao and Zhe Chen and Ya Zhang and Yanfeng Wang and Yu Wang},\n title = {MedS$^3$: Towards Medical Small Language Models with Self-Evolved Slow Thinking},\n year = {2025},\n archiveprefix = {arXiv},\n eprint ... |
modernbert_predict_masked | {
"branch": null,
"commit": "8c57a0f",
"env": [],
"info": "ModernBERT from https://github.com/AnswerDotAI/ModernBERT (at commit: 8c57a0f)",
"name": "ModernBERT",
"url": "https://github.com/AnswerDotAI/ModernBERT"
} | cpu | [
"warner2024modernbert"
] | llms | Given a masked sentence string, predict the original sentence using the pretrained ModernBERT-base model on CPU. | [
{
"description": "The masked sentence string. The masked part is represented by \"[MASK]\"\".",
"name": "input_string",
"type": "str"
}
] | [
{
"description": "The predicted original sentence (including the predicted masked part)",
"name": "prediction",
"type": "str"
}
] | {
"arguments": [
{
"name": "input_string",
"value": "\"Paris is the [MASK] of France.\""
}
],
"mount": [],
"name": "example"
} | [
{
"arguments": [
{
"name": "input_string",
"value": "\"He walked to the [MASK].\""
}
],
"mount": [],
"name": "walking"
},
{
"arguments": [
{
"name": "input_string",
"value": "\"The future of AI is [MASK].\""
}
],
"mount": [],
... | null | def modernbert_predict_masked(input_string: str = 'Paris is the [MASK] of France.') -> dict:
"""
Given a masked sentence string, predict the original sentence using the pretrained ModernBERT-base model on CPU.
Args:
input_string: The masked sentence string. The masked part is represented by "[M... | <description>
Given a masked sentence string, predict the original sentence using the pretrained ModernBERT-base model on CPU.
</description>
<arguments>
input_string (str): The masked sentence string. The masked part is represented by "[MASK]"". (example: 'Paris is the [MASK] of France.')
</arguments>
<returns>
dict w... | [
{
"bibtex": "@misc{warner2024modernbert,\n author = {Benjamin Warner and Antoine Chaffin and Benjamin Clavié and Orion Weller and Oskar Hallström and Said Taghadouini and Alexis Gallagher and Raja Biswas and Faisal Ladhak and Tom Aarsen and Nathan Cooper and Griffin Adams and Jeremy Howard and Iacopo Po... |
mopadi_generate_counterfactuals | {
"branch": null,
"commit": "4e76820",
"env": [
{
"name": "HF_TOKEN",
"value": "${env:HF_TOKEN}"
}
],
"info": "mopadi from https://github.com/KatherLab/mopadi (at commit: 4e76820)",
"name": "mopadi",
"url": "https://github.com/KatherLab/mopadi"
} | cuda | [
"zigutyte2024mopadi"
] | pathology | Generate counterfactual explanations for the top 3 tiles per patient by manipulating them with a specific amplitude, such that the predicted class of each counterfactual image flips to the opposite class (i.e., the predicted output for the opposite class exceeds 0.9), while avoiding excessive overmanipulation. Use a pr... | [
{
"description": "Path to the folder containing patient subfolders with image patches",
"name": "images_dir",
"type": "str"
},
{
"description": "Path to the folder containing extracted features for each patient",
"name": "feat_path_test",
"type": "str"
},
{
"description": "Path t... | [
{
"description": "The number of counterfactual images that were generated",
"name": "num_counterfactuals",
"type": "int"
}
] | {
"arguments": [
{
"name": "images_dir",
"value": "\"/mount/input/images/TCGA-CRC\""
},
{
"name": "feat_path_test",
"value": "\"/mount/input/features/TCGA-CRC\""
},
{
"name": "clini_table",
"value": "\"/mount/input/TCGA-CRC-DX_CLINI.xlsx\""
},
{
"n... | [
{
"arguments": [
{
"name": "images_dir",
"value": "\"/mount/input/images/TCGA-BRCA\""
},
{
"name": "feat_path_test",
"value": "\"/mount/input/features/TCGA-BRCA\""
},
{
"name": "clini_table",
"value": "\"/mount/input/TCGA-BRCA-DX_CLIN... | null | def mopadi_generate_counterfactuals(images_dir: str = '/mount/input/images/TCGA-CRC', feat_path_test: str = '/mount/input/features/TCGA-CRC', clini_table: str = '/mount/input/TCGA-CRC-DX_CLINI.xlsx', target_label: str = 'isMSIH', base_dir: str = '/mount/output/counterfactuals_crc_msi', manipulation_levels: list = [0.06... | <description>
Generate counterfactual explanations for the top 3 tiles per patient by manipulating them with a specific amplitude, such that the predicted class of each counterfactual image flips to the opposite class (i.e., the predicted output for the opposite class exceeds 0.9), while avoiding excessive overmanipula... | [
{
"bibtex": "@misc{zigutyte2024mopadi,\n author = {Laura Žigutytė and Tim Lenz and Tianyu Han and Katherine Jane Hewitt and Nic Gabriel Reitsam and Sebastian Foersch and Zunamys I Carrero and Michaela Unger and Alexander T Pearson and Daniel Truhn and Jakob Nikolas Kather},\n title = {ounterfac... |
musk_extract_features | {
"branch": null,
"commit": "e1699c2",
"env": [
{
"name": "HF_TOKEN",
"value": "${env:HF_TOKEN}"
}
],
"info": "MUSK from https://github.com/lilab-stanford/MUSK (at commit: e1699c2)",
"name": "MUSK",
"url": "https://github.com/lilab-stanford/MUSK"
} | cuda | [
"xiang2025musk"
] | pathology | Perform feature extraction on an input image using the vision part of MUSK. | [
{
"description": "Path to the input image",
"name": "input_image",
"type": "str"
}
] | [
{
"description": "The feature vector extracted from the input image, as a list of floats",
"name": "features",
"type": "list"
}
] | {
"arguments": [
{
"name": "input_image",
"value": "\"/mount/input/TUM/TUM-TCGA-ACRLPPQE.tif\""
}
],
"mount": [
{
"source": "TUM-TCGA-ACRLPPQE.tif",
"target": "TUM/TUM-TCGA-ACRLPPQE.tif"
}
],
"name": "example"
} | [
{
"arguments": [
{
"name": "input_image",
"value": "\"/mount/input/MUC/MUC-TCGA-ACCPKIPN.tif\""
}
],
"mount": [
{
"source": "MUC-TCGA-ACCPKIPN.tif",
"target": "MUC/MUC-TCGA-ACCPKIPN.tif"
}
],
"name": "kather100k_muc"
},
{
"arguments... | null | def musk_extract_features(input_image: str = '/mount/input/TUM/TUM-TCGA-ACRLPPQE.tif') -> dict:
"""
Perform feature extraction on an input image using the vision part of MUSK.
Args:
input_image: Path to the input image
Returns:
dict with the following structure:
{
... | <description>
Perform feature extraction on an input image using the vision part of MUSK.
</description>
<arguments>
input_image (str): Path to the input image (example: '/mount/input/TUM/TUM-TCGA-ACRLPPQE.tif')
</arguments>
<returns>
dict with the following structure:
{
'features': list # The feature vector extract... | [
{
"bibtex": "@article{xiang2025musk,\n author = {Xiang, Jinxi and Wang, Xiyue and Zhang, Xiaoming and Xi, Yinghua and Eweje, Feyisope and Chen, Yijiang and Li, Yuchen and Bergstrom, Colin and Gopaulchan, Matthew and Kim, Ted and Yu, Kun-Hsing and Willens, Sierra and Olguin, Francesca Maria and ... |
nnunet_preprocess | {
"branch": null,
"commit": "58a3b12",
"env": [],
"info": "nnUNet from https://github.com/MIC-DKFZ/nnUNet (at commit: 58a3b12)",
"name": "nnUNet",
"url": "https://github.com/MIC-DKFZ/nnUNet"
} | cpu | [
"isensee2020nnunet"
] | radiology | Preprocess a dataset using nnUNetv2. The dataset is in the old Medical Segmentation Decathlon (MSD) format and will need to be converted. Does not require GPU. | [
{
"description": "The path to the dataset folder to train the model on (in MSD format, so contains dataset.json, imagesTr, imagesTs, labelsTr)",
"name": "dataset_path",
"type": "str"
}
] | [
{
"description": "The dataset config object (dataset.json) created by nnUNetv2, as the parsed json object",
"name": "dataset_json",
"type": "dict"
},
{
"description": "The nnUNetv2 plan file (nnUNetPlans.json) created by nnUNetv2, as the parsed json object",
"name": "nnUNetPlans_json",
"... | {
"arguments": [
{
"name": "dataset_path",
"value": "\"/mount/input/Task02_Heart\""
}
],
"mount": [
{
"source": "msd/Task02_Heart",
"target": "Task02_Heart"
}
],
"name": "example"
} | [
{
"arguments": [
{
"name": "dataset_path",
"value": "\"/mount/input/Task05_Prostate\""
}
],
"mount": [
{
"source": "msd/Task05_Prostate",
"target": "Task05_Prostate"
}
],
"name": "prostate"
},
{
"arguments": [
{
"name"... | Use the UNet model from DKFZ to train a medical segmentation model. More info here: https://github.com/MIC-DKFZ/nnUNet/blob/master/documentation/how_to_use_nnunet.md https://github.com/MIC-DKFZ/nnUNet/blob/master/documentation/dataset_format.md | def nnunet_preprocess(dataset_path: str = '/mount/input/Task02_Heart') -> dict:
"""
Preprocess a dataset using nnUNetv2. The dataset is in the old Medical Segmentation Decathlon (MSD) format and will need to be converted. Does not require GPU.
Args:
dataset_path: The path to the dataset folder ... | <description>
Preprocess a dataset using nnUNetv2. The dataset is in the old Medical Segmentation Decathlon (MSD) format and will need to be converted. Does not require GPU.
</description>
<arguments>
dataset_path (str): The path to the dataset folder to train the model on (in MSD format, so contains dataset.json, imag... | [
{
"bibtex": "@article{isensee2020nnunet,\n author = {Isensee, Fabian and Jaeger, Paul F. and Kohl, Simon A. A. and Petersen, Jens and Maier-Hein, Klaus H.},\n title = {nnU-Net: a self-configuring method for deep learning-based biomedical image segmentation},\n year = {2020},\n journal = {... |
pathfinder_verify_biomarker | {
"branch": null,
"commit": "093d77b",
"env": [],
"info": "PathFinder from https://github.com/LiangJunhao-THU/PathFinderCRC (at commit: 093d77b)",
"name": "PathFinder",
"url": "https://github.com/LiangJunhao-THU/PathFinderCRC"
} | cpu | [
"liang2023pathfinder"
] | pathology | Given WSI probability maps, a hypothesis of a potential biomarker, and clinical data, determine (1) whether the potential biomarker is significant for patient prognosis, and (2) whether the potential biomarker is independent among already known biomarkers. | [
{
"description": "Path to the folder containing the numpy array (`*.npy`) files, which contains the heatmaps of the trained model (each heatmap is HxWxC where C is the number of classes)",
"name": "heatmaps",
"type": "str"
},
{
"description": "A python file, which contains a function `def hypoth... | [
{
"description": "The p-value of the significance of the potential biomarker",
"name": "p_value",
"type": "float"
},
{
"description": "The hazard ratio for the biomarker",
"name": "hazard_ratio",
"type": "float"
}
] | {
"arguments": [
{
"name": "heatmaps",
"value": "\"/mount/input/TCGA_CRC\""
},
{
"name": "hypothesis",
"value": "\"/mount/input/mus_fraction_score.py\""
},
{
"name": "clini_table",
"value": "\"/mount/input/TCGA_CRC_info.csv\""
},
{
"name": "files_t... | [
{
"arguments": [
{
"name": "heatmaps",
"value": "\"/mount/input/TCGA_CRC\""
},
{
"name": "hypothesis",
"value": "\"/mount/input/tum_fraction_score.py\""
},
{
"name": "clini_table",
"value": "\"/mount/input/TCGA_CRC_info.csv\""
}... | null | def pathfinder_verify_biomarker(heatmaps: str = '/mount/input/TCGA_CRC', hypothesis: str = '/mount/input/mus_fraction_score.py', clini_table: str = '/mount/input/TCGA_CRC_info.csv', files_table: str = '/mount/input/TCGA_CRC_files.csv', survival_time_column: str = 'OS.time', event_column: str = 'vital_status', known_bio... | <description>
Given WSI probability maps, a hypothesis of a potential biomarker, and clinical data, determine (1) whether the potential biomarker is significant for patient prognosis, and (2) whether the potential biomarker is independent among already known biomarkers.
</description>
<arguments>
heatmaps (str): Path t... | [
{
"bibtex": "@article{liang2023pathfinder,\n author = {Liang, Junhao and Zhang, Weisheng and Yang, Jianghui and Wu, Meilong and Dai, Qionghai and Yin, Hongfang and Xiao, Ying and Kong, Lingjie},\n title = {Deep learning supported discovery of biomarkers for clinical prognosis of liver cancer},\... |
retfound_feature_vector | {
"branch": null,
"commit": "897d71c",
"env": [
{
"name": "HF_TOKEN",
"value": "${env:HF_TOKEN}"
}
],
"info": "RETFound from https://github.com/rmaphoh/RETFound_MAE (at commit: 897d71c)",
"name": "RETFound",
"url": "https://github.com/rmaphoh/RETFound_MAE"
} | cuda | [
"zhou2023retfound"
] | misc | Extract the latent feature vector for the given retinal image using the RETFound pretrained RETFound_mae_natureCFP model. | [
{
"description": "Path to the retinal image.",
"name": "image_file",
"type": "str"
}
] | [
{
"description": "The feature vector for the given retinal image, as a list of floats.",
"name": "feature_vector",
"type": "list"
}
] | {
"arguments": [
{
"name": "image_file",
"value": "\"/mount/input/retinal_image.jpg\""
}
],
"mount": [
{
"source": "cucumber.jpg",
"target": "retinal_image.jpg"
}
],
"name": "example"
} | [
{
"arguments": [
{
"name": "image_file",
"value": "\"/mount/input/image1.jpg\""
}
],
"mount": [
{
"source": "TCGA-BRCA_patch_TCGA-BH-A0DE-01Z-00-DX1.64A0340A-8146-48E8-AAF7-4035988B9152.jpg",
"target": "image1.jpg"
}
],
"name": "jpg"
},
... | null | def retfound_feature_vector(image_file: str = '/mount/input/retinal_image.jpg') -> dict:
"""
Extract the latent feature vector for the given retinal image using the RETFound pretrained RETFound_mae_natureCFP model.
Args:
image_file: Path to the retinal image.
Returns:
dict with... | <description>
Extract the latent feature vector for the given retinal image using the RETFound pretrained RETFound_mae_natureCFP model.
</description>
<arguments>
image_file (str): Path to the retinal image. (example: '/mount/input/retinal_image.jpg')
</arguments>
<returns>
dict with the following structure:
{
'featu... | [
{
"bibtex": "@article{zhou2023retfound,\n author = {Zhou, Yukun and Chia, Mark A. and Wagner, Siegfried K. and Ayhan, Murat S. and Williamson, Dominic J. and Struyven, Robbert R. and Liu, Timing and Xu, Moucheng and Lozano, Mateo G. and Woodward-Court, Peter and Kihara, Yuka and Allen, Naomi and... |
stamp_extract_features | {
"branch": null,
"commit": "97522aa",
"env": [],
"info": "STAMP from https://github.com/KatherLab/STAMP (at commit: 97522aa)",
"name": "STAMP",
"url": "https://github.com/KatherLab/STAMP"
} | cuda | [
"elnahhas2024stamp"
] | pathology | Perform feature extraction using CTransPath with STAMP on a set of whole slide images, saving the resulting features to the specified output directory. | [
{
"description": "Path to the output folder where the features will be saved",
"name": "output_dir",
"type": "str"
},
{
"description": "Path to the input folder containing the whole slide images",
"name": "slide_dir",
"type": "str"
}
] | [
{
"description": "The number of slides that were processed",
"name": "num_processed_slides",
"type": "int"
}
] | {
"arguments": [
{
"name": "output_dir",
"value": "\"/mount/output/TCGA-BRCA-features\""
},
{
"name": "slide_dir",
"value": "\"/mount/input/TCGA-BRCA-SLIDES\""
}
],
"mount": [
{
"source": "brca",
"target": "TCGA-BRCA-SLIDES"
}
],
"name": "example"
} | [
{
"arguments": [
{
"name": "output_dir",
"value": "\"/mount/output/TCGA-CRC-features\""
},
{
"name": "slide_dir",
"value": "\"/mount/input/TCGA-CRC-SLIDES\""
}
],
"mount": [
{
"source": "crc",
"target": "TCGA-CRC-SLIDES"
... | null | def stamp_extract_features(output_dir: str = '/mount/output/TCGA-BRCA-features', slide_dir: str = '/mount/input/TCGA-BRCA-SLIDES') -> dict:
"""
Perform feature extraction using CTransPath with STAMP on a set of whole slide images, saving the resulting features to the specified output directory.
Args:
... | <description>
Perform feature extraction using CTransPath with STAMP on a set of whole slide images, saving the resulting features to the specified output directory.
</description>
<arguments>
output_dir (str): Path to the output folder where the features will be saved (example: '/mount/output/TCGA-BRCA-features')
slid... | [
{
"bibtex": "@article{elnahhas2024stamp,\n author = {El Nahhas, Omar S. M. and van Treeck, Marko and W\\\"{o}lflein, Georg and Unger, Michaela and Ligero, Marta and Lenz, Tim and Wagner, Sophia J. and Hewitt, Katherine J. and Khader, Firas and Foersch, Sebastian and Truhn, Daniel and Kather, Jak... |
stamp_train_classification_model | {
"branch": null,
"commit": "97522aa",
"env": [],
"info": "STAMP from https://github.com/KatherLab/STAMP (at commit: 97522aa)",
"name": "STAMP",
"url": "https://github.com/KatherLab/STAMP"
} | cuda | [
"elnahhas2024stamp"
] | pathology | Train a model for biomarker classification. You will be supplied with the path to the folder containing the whole slide images, alongside a path to a CSV file containing the training labels. Use ctranspath for feature extraction. | [
{
"description": "Path to the folder containing the whole slide images",
"name": "slide_dir",
"type": "str"
},
{
"description": "Path to the CSV file containing the clinical data",
"name": "clini_table",
"type": "str"
},
{
"description": "Path to the CSV file containing the slide... | [
{
"description": "The number of parameters in the trained model",
"name": "num_params",
"type": "int"
}
] | {
"arguments": [
{
"name": "slide_dir",
"value": "\"/mount/input/TCGA-BRCA-SLIDES\""
},
{
"name": "clini_table",
"value": "\"/mount/input/TCGA-BRCA-DX_CLINI.xlsx\""
},
{
"name": "slide_table",
"value": "\"/mount/input/TCGA-BRCA-DX_SLIDE.csv\""
},
{
... | [
{
"arguments": [
{
"name": "slide_dir",
"value": "\"/mount/input/TCGA-CRC-SLIDES\""
},
{
"name": "clini_table",
"value": "\"/mount/input/TCGA-CRC-DX_CLINI.xlsx\""
},
{
"name": "slide_table",
"value": "\"/mount/input/TCGA-CRC-DX_SLIDE.... | Here, the agent must realize that it needs to perform feature extraction before training the model. | def stamp_train_classification_model(slide_dir: str = '/mount/input/TCGA-BRCA-SLIDES', clini_table: str = '/mount/input/TCGA-BRCA-DX_CLINI.xlsx', slide_table: str = '/mount/input/TCGA-BRCA-DX_SLIDE.csv', target_column: str = 'TP53_driver', trained_model_path: str = '/mount/output/STAMP-BRCA-TP53-model.ckpt') -> dict:
... | <description>
Train a model for biomarker classification. You will be supplied with the path to the folder containing the whole slide images, alongside a path to a CSV file containing the training labels. Use ctranspath for feature extraction.
</description>
<arguments>
slide_dir (str): Path to the folder containing th... | [
{
"bibtex": "@article{elnahhas2024stamp,\n author = {El Nahhas, Omar S. M. and van Treeck, Marko and W\\\"{o}lflein, Georg and Unger, Michaela and Ligero, Marta and Lenz, Tim and Wagner, Sophia J. and Hewitt, Katherine J. and Khader, Firas and Foersch, Sebastian and Truhn, Daniel and Kather, Jak... |
tabpfn_predict | {
"branch": null,
"commit": "e8744e4",
"env": [],
"info": "TabPFN from https://github.com/PriorLabs/TabPFN (at commit: e8744e4)",
"name": "TabPFN",
"url": "https://github.com/PriorLabs/TabPFN"
} | cpu | [
"hollmann2025tabpfn"
] | misc | Train a predictor using TabPFN on a tabular dataset. Evaluate the predictor on the test set. Train on CPU. | [
{
"description": "Path to the CSV file containing the training data",
"name": "train_csv",
"type": "str"
},
{
"description": "Path to the CSV file containing the test data",
"name": "test_csv",
"type": "str"
},
{
"description": "The names of the columns to use as features",
"... | [
{
"description": "The ROC AUC score of the predictor on the test set",
"name": "roc_auc",
"type": "float"
},
{
"description": "The accuracy of the predictor on the test set",
"name": "accuracy",
"type": "float"
},
{
"description": "The probabilities of the predictor on the test s... | {
"arguments": [
{
"name": "train_csv",
"value": "\"/mount/input/breast_cancer_train.csv\""
},
{
"name": "test_csv",
"value": "\"/mount/input/breast_cancer_test.csv\""
},
{
"name": "feature_columns",
"value": "[\"mean radius\", \"mean texture\", \"mean perimeter... | [
{
"arguments": [
{
"name": "train_csv",
"value": "\"/mount/input/diabetes_train.csv\""
},
{
"name": "test_csv",
"value": "\"/mount/input/diabetes_test.csv\""
},
{
"name": "feature_columns",
"value": "[\"preg\", \"plas\", \"pres\", \"s... | null | def tabpfn_predict(train_csv: str = '/mount/input/breast_cancer_train.csv', test_csv: str = '/mount/input/breast_cancer_test.csv', feature_columns: list = ['mean radius', 'mean texture', 'mean perimeter', 'mean area', 'mean smoothness', 'mean compactness', 'mean concavity', 'mean concave points', 'mean symmetry', 'mean... | <description>
Train a predictor using TabPFN on a tabular dataset. Evaluate the predictor on the test set. Train on CPU.
</description>
<arguments>
train_csv (str): Path to the CSV file containing the training data (example: '/mount/input/breast_cancer_train.csv')
test_csv (str): Path to the CSV file containing the tes... | [
{
"bibtex": "@article{hollmann2025tabpfn,\n author = {Hollmann, Noah and M\\\"{u}ller, Samuel and Purucker, Lennart and Krishnakumar, Arjun and K\\\"{o}rfer, Max and Hoo, Shi Bin and Schirrmeister, Robin Tibor and Hutter, Frank},\n title = {Accurate predictions on small data with a tabular foun... |
textgrad_medical_qa_optimize | {
"branch": null,
"commit": "bf5b0c5",
"env": [
{
"name": "OPENAI_API_KEY",
"value": "${env:OPENAI_API_KEY}"
}
],
"info": "textgrad from https://github.com/zou-group/textgrad (at commit: bf5b0c5)",
"name": "textgrad",
"url": "https://github.com/zou-group/textgrad"
} | cpu | [
"yuksekgonul2024textgrad"
] | llms | Optimize answers to multiple-choice medical questions using TextGrad. Each question is improved at test-time through textual gradients, guided by an objective (e.g. "Make the answer concise and accurate").
| [
{
"description": "Path to a CSV file containing columns: 'index', 'question', 'objective'",
"name": "csv_path",
"type": "str"
},
{
"description": "The model used to compute textual gradients (e.g., 'gpt-4o')",
"name": "backward_engine",
"type": "str"
},
{
"description": "The mode... | [
{
"description": "A list of optimized answers, each ending with 'Answer: $LETTER'",
"name": "optimized_answers",
"type": "list"
}
] | {
"arguments": [
{
"name": "csv_path",
"value": "\"/mount/input/sample_0.csv\""
},
{
"name": "backward_engine",
"value": "\"gpt-4o\""
},
{
"name": "forward_engine",
"value": "\"gpt-4o\""
},
{
"name": "starting_system_prompt",
"value": "\"You ... | [
{
"arguments": [
{
"name": "csv_path",
"value": "\"/mount/input/sample_0.csv\""
},
{
"name": "backward_engine",
"value": "\"gpt-4o\""
},
{
"name": "forward_engine",
"value": "\"gpt-4\""
},
{
"name": "starting_syste... | null | def textgrad_medical_qa_optimize(csv_path: str = '/mount/input/sample_0.csv', backward_engine: str = 'gpt-4o', forward_engine: str = 'gpt-4o', starting_system_prompt: str = 'You are ChatGPT, a large language model trained by OpenAI, based on the GPT-4 architecture.\nKnowledge cutoff: 2023-12\nCurrent date: 2024-04-01\n... | <description>
Optimize answers to multiple-choice medical questions using TextGrad. Each question is improved at test-time through textual gradients, guided by an objective (e.g. "Make the answer concise and accurate").
</description>
<arguments>
csv_path (str): Path to a CSV file containing columns: 'index', 'questi... | [
{
"bibtex": "@misc{yuksekgonul2024textgrad,\n author = {Yuksekgonul, Mert and Bianchi, Federico and Boen, Joseph and Liu, Sheng and Huang, Zhi and Guestrin, Carlos and Zou, James},\n title = {{TextGrad}: Automatic \"differentiation\" via text},\n year = {2024},\n archiveprefix = {arX... |
tiatoolbox_wsi_dimensions | {
"branch": null,
"commit": "7ba7394",
"env": [],
"info": "tiatoolbox from https://github.com/TissueImageAnalytics/tiatoolbox (at commit: 7ba7394)",
"name": "tiatoolbox",
"url": "https://github.com/TissueImageAnalytics/tiatoolbox"
} | cpu | [
"pocock2022tiatoolbox"
] | pathology | Determine the pixel dimensions for every whole slide image (WSI) in `input_dir` using TIAToolbox. | [
{
"description": "Path to the folder that contains the WSIs",
"name": "input_dir",
"type": "str"
},
{
"description": "Whether to include every pyramid level instead of only the baseline dimensions",
"name": "include_pyramid",
"type": "bool"
}
] | [
{
"description": "Dimensions of the WSI (optionally with of without full pyramid values) as a dict of {slide_filename: {\"baseline\": [width, height], \"levels\": [[width, height], ...]}}, where `baseline` is the dimensions of the WSI at the highest resolution and `levels` is a list of dimensions for each py... | {
"arguments": [
{
"name": "input_dir",
"value": "\"/mount/input/wsis\""
},
{
"name": "include_pyramid",
"value": "true"
}
],
"mount": [
{
"source": "wsis",
"target": "wsis"
}
],
"name": "example"
} | [
{
"arguments": [
{
"name": "input_dir",
"value": "\"/mount/input/wsis\""
},
{
"name": "include_pyramid",
"value": "false"
}
],
"mount": [
{
"source": "wsis/TCGA-DT-5265-01Z-00-DX1.563f09af-8bbe-45cd-9c6d-85a96255e67f.svs",
"ta... | null | def tiatoolbox_wsi_dimensions(input_dir: str = '/mount/input/wsis', include_pyramid: bool = True) -> dict:
"""
Determine the pixel dimensions for every whole slide image (WSI) in `input_dir` using TIAToolbox.
Args:
input_dir: Path to the folder that contains the WSIs
include_pyramid: Wh... | <description>
Determine the pixel dimensions for every whole slide image (WSI) in `input_dir` using TIAToolbox.
</description>
<arguments>
input_dir (str): Path to the folder that contains the WSIs (example: '/mount/input/wsis')
include_pyramid (bool): Whether to include every pyramid level instead of only the baseline... | [
{
"bibtex": "@article{pocock2022tiatoolbox,\n author = {Pocock, Johnathan and Graham, Simon and Vu, Quoc Dang and Jahanifar, Mostafa and Deshpande, Srijay and Hadjigeorghiou, Giorgos and Shephard, Adam and Bashir, Raja Muhammad Saad and Bilal, Mohsin and Lu, Wenqi and others},\n title = {TIAToolbox as ... |
tiatoolbox_wsi_thumbnailer | {
"branch": null,
"commit": "7ba7394",
"env": [],
"info": "tiatoolbox from https://github.com/TissueImageAnalytics/tiatoolbox (at commit: 7ba7394)",
"name": "tiatoolbox",
"url": "https://github.com/TissueImageAnalytics/tiatoolbox"
} | cpu | [
"pocock2022tiatoolbox"
] | pathology | Generate a PNG thumbnail for every whole-slide image (WSI) in `input_dir` using TIAToolbox and save them to `output_dir` with the suffix “_thumbnail.png”. | [
{
"description": "Path to the folder that contains the WSIs",
"name": "input_dir",
"type": "str"
},
{
"description": "Path to the folder where thumbnails are written",
"name": "output_dir",
"type": "str"
},
{
"description": "Requested magnification / physical resolution",
"na... | [
{
"description": "Number of thumbnails created",
"name": "num_thumbnails",
"type": "int"
}
] | {
"arguments": [
{
"name": "input_dir",
"value": "\"/mount/input/wsis\""
},
{
"name": "output_dir",
"value": "\"/mount/output/wsis_thumbs\""
},
{
"name": "resolution",
"value": "1.25"
},
{
"name": "units",
"value": "\"power\""
}
],
"m... | [
{
"arguments": [
{
"name": "input_dir",
"value": "\"/mount/input/wsis\""
},
{
"name": "output_dir",
"value": "\"/mount/output/wsis_thumbs\""
},
{
"name": "resolution",
"value": "0.625"
},
{
"name": "units",
... | null | def tiatoolbox_wsi_thumbnailer(input_dir: str = '/mount/input/wsis', output_dir: str = '/mount/output/wsis_thumbs', resolution: float = 1.25, units: str = 'power') -> dict:
"""
Generate a PNG thumbnail for every whole-slide image (WSI) in `input_dir` using TIAToolbox and save them to `output_dir` with the suffi... | <description>
Generate a PNG thumbnail for every whole-slide image (WSI) in `input_dir` using TIAToolbox and save them to `output_dir` with the suffix “_thumbnail.png”.
</description>
<arguments>
input_dir (str): Path to the folder that contains the WSIs (example: '/mount/input/wsis')
output_dir (str): Path to the fold... | [
{
"bibtex": "@article{pocock2022tiatoolbox,\n author = {Pocock, Johnathan and Graham, Simon and Vu, Quoc Dang and Jahanifar, Mostafa and Deshpande, Srijay and Hadjigeorghiou, Giorgos and Shephard, Adam and Bashir, Raja Muhammad Saad and Bilal, Mohsin and Lu, Wenqi and others},\n title = {TIAToolbox as ... |
totalsegmentator_segment_liver | {
"branch": null,
"commit": "5b1a4f0",
"env": [],
"info": "TotalSegmentator from https://github.com/wasserth/TotalSegmentator (at commit: 5b1a4f0)",
"name": "TotalSegmentator",
"url": "https://github.com/wasserth/TotalSegmentator"
} | cuda | [
"wasserthal2023totalsegmentator"
] | radiology | Segment the liver vessels from the input CT scan(s) and save the result as a .nii.gz file. In the output segmentation, liver vessel voxels must have the value 1, and all other voxels must be 0. | [
{
"description": "Path to the input image in .nii.gz format",
"name": "ct_input_path",
"type": "str"
},
{
"description": "Path to the output file (liver vessels segmentation mask) in .nii.gz format",
"name": "segmentation_mask_output_path",
"type": "str"
}
] | [] | {
"arguments": [
{
"name": "ct_input_path",
"value": "\"/mount/input/CRLM-CT-1040_0000.nii.gz\""
},
{
"name": "segmentation_mask_output_path",
"value": "\"/mount/output/CRLM-CT-1040_0000_seg_mask.nii.gz\""
}
],
"mount": [
{
"source": "CRLM-CT-1040_0000.nii.gz",
... | [
{
"arguments": [
{
"name": "ct_input_path",
"value": "\"/mount/input/CRLM-CT-1085_0000.nii.gz\""
},
{
"name": "segmentation_mask_output_path",
"value": "\"/mount/output/CRLM-CT-1085_0000_seg_mask.nii.gz\""
}
],
"mount": [
{
"source": ... | null | def totalsegmentator_segment_liver(ct_input_path: str = '/mount/input/CRLM-CT-1040_0000.nii.gz', segmentation_mask_output_path: str = '/mount/output/CRLM-CT-1040_0000_seg_mask.nii.gz') -> dict:
"""
Segment the liver vessels from the input CT scan(s) and save the result as a .nii.gz file. In the output segmentat... | <description>
Segment the liver vessels from the input CT scan(s) and save the result as a .nii.gz file. In the output segmentation, liver vessel voxels must have the value 1, and all other voxels must be 0.
</description>
<arguments>
ct_input_path (str): Path to the input image in .nii.gz format (example: '/mount/inpu... | [
{
"bibtex": "@article{wasserthal2023totalsegmentator,\n author = {Wasserthal, Jakob and Breit, Hanns-Christian and Meyer, Manfred T and Pradella, Maurice and Hinck, Daniel and Sauter, Alexander W and Heye, Tobias and Boll, Daniel T and Cyriac, Joshy and Yang, Shan and others},\n title = {TotalSegmentat... |
uni_extract_features | {
"branch": null,
"commit": "42715ef",
"env": [
{
"name": "HF_TOKEN",
"value": "${env:HF_TOKEN}"
}
],
"info": "UNI from https://github.com/mahmoodlab/UNI (at commit: 42715ef)",
"name": "UNI",
"url": "https://github.com/mahmoodlab/UNI"
} | cuda | [
"chen2024uni"
] | pathology | Perform feature extraction on an input image using the "UNI" model. | [
{
"description": "Path to the input image",
"name": "input_image",
"type": "str"
}
] | [
{
"description": "The feature vector extracted from the input image, as a list of floats",
"name": "features",
"type": "list"
}
] | {
"arguments": [
{
"name": "input_image",
"value": "\"/mount/input/TUM/TUM-TCGA-ACRLPPQE.tif\""
}
],
"mount": [
{
"source": "TUM-TCGA-ACRLPPQE.tif",
"target": "TUM/TUM-TCGA-ACRLPPQE.tif"
}
],
"name": "example"
} | [
{
"arguments": [
{
"name": "input_image",
"value": "\"/mount/input/MUC/MUC-TCGA-ACCPKIPN.tif\""
}
],
"mount": [
{
"source": "MUC-TCGA-ACCPKIPN.tif",
"target": "MUC/MUC-TCGA-ACCPKIPN.tif"
}
],
"name": "kather100k_muc"
},
{
"arguments... | null | def uni_extract_features(input_image: str = '/mount/input/TUM/TUM-TCGA-ACRLPPQE.tif') -> dict:
"""
Perform feature extraction on an input image using the "UNI" model.
Args:
input_image: Path to the input image
Returns:
dict with the following structure:
{
'fea... | <description>
Perform feature extraction on an input image using the "UNI" model.
</description>
<arguments>
input_image (str): Path to the input image (example: '/mount/input/TUM/TUM-TCGA-ACRLPPQE.tif')
</arguments>
<returns>
dict with the following structure:
{
'features': list # The feature vector extracted from ... | [
{
"bibtex": "@article{chen2024uni,\n author = {Chen, Richard J. and Ding, Tong and Lu, Ming Y. and Williamson, Drew F. K. and Jaume, Guillaume and Song, Andrew H. and Chen, Bowen and Zhang, Andrew and Shao, Daniel and Shaban, Muhammad and Williams, Mane and Oldenburg, Lukas and Weishaupt, Luca ... |
README.md exists but content is empty.
- Downloads last month
- 15