Biological Process
stringlengths
7
1.01k
Cellular Component
stringlengths
6
867
Molecular Function
stringlengths
11
871
Organism
stringlengths
8
73
Keywords
stringlengths
1
810
Sequence 10
stringlengths
5
10
Sequence
stringlengths
5
1.02k
Combined
stringlengths
136
3.91k
archaeal or bacterial-type flagellum-dependent cell motility chemotaxis phosphorelay signal transduction system
cytoplasm
metal ion binding
Vibrio cholerae serotype O1
3D-structure Chemotaxis Cytoplasm Flagellar rotation Magnesium Metal-binding Phosphoprotein Two-component regulatory system
MEAILNKNMK
MEAILNKNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDFDFVVTDWNMPGMQGIDLLKNIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFERL
archaeal or bacterial-type flagellum-dependent cell motility chemotaxis phosphorelay signal transduction system cytoplasm metal ion binding Vibrio cholerae serotype O1 3D-structure Chemotaxis Cytoplasm Flagellar rotation Magnesium Metal-binding Phosphoprotein Two-component regulatory system MEAILNKNMK MEAILNKNMKILIVDDF...
autolysis carbohydrate metabolic process cell wall modification evasion of host immune response evasion of host immune response via modulation of host cytokine network negative regulation of lysozyme activity
extracellular region; Gram-positive-bacterium-type cell wall; plasma membrane
lysozyme inhibitor activity N-acetylglucosamine deacetylase activity protein homodimerization activity zinc ion binding
Listeria monocytogenes serotype 1/2a
Cell membrane Cell wall Hydrolase Membrane Metal-binding Secreted Transmembrane Transmembrane helix Virulence Zinc
MKIRWIRLSL
MKIRWIRLSLVAILIIAVVFIGVIGFQKYQFSKSRNKVIMQMDRLMKDQDGGNFRRLDKKENGVEIISYIPKTTEKKDNEIIQKEIGKATDAEVKKLNRDKETQGIIFYTYQKHRMAEQAISYKAVQSEYVKEGRTKFVLKDKKDICKNIVTDAETGALLTLGEVLIKSNQTKLNLKTAVEEELIKTGDFSLKDVGNLGKIKSLVKWNQTDFEITNSEIILPVKIPGAPEPKKVKVKLADIASSVNKRYLPSSVKVPEVPKAKTNKRIALTFDDGPSSSVTPGVLDTLKRHNVKATFFVLGSSVIQNPGLVKRELEEGHQ...
autolysis carbohydrate metabolic process cell wall modification evasion of host immune response evasion of host immune response via modulation of host cytokine network negative regulation of lysozyme activity extracellular region; Gram-positive-bacterium-type cell wall; plasma membrane lysozyme inhibitor activity N-ace...
zinc ion transport
plasma membrane
metal ion transmembrane transporter activity
Bordetella bronchiseptica
3D-structure Cadmium Cell inner membrane Cell membrane Ion transport Membrane Transmembrane Transmembrane helix Transport Zinc Zinc transport
MNQPSSLAAD
MNQPSSLAADLRGAWHAQAQSHPLITLGLAASAAGVVLLLVAGIVNALTGENRVHVGYAVLGGAAGFAATALGALMALGLRAISARTQDAMLGFAAGMMLAASAFSLILPGLDAAGTIVGPGPAAAAVVALGLGLGVLLMLGLDYFTPHEHERTGHQGPEAARVNRVWLFVLTIILHNLPEGMAIGVSFATGDLRIGLPLTSAIAIQDVPEGLAVALALRAVGLPIGRAVLVAVASGLMEPLGALVGVGISSGFALAYPISMGLAAGAMIFVVSHEVIPETHRNGHETTATVGLMAGFALMMFLDTALG
zinc ion transport plasma membrane metal ion transmembrane transporter activity Bordetella bronchiseptica 3D-structure Cadmium Cell inner membrane Cell membrane Ion transport Membrane Transmembrane Transmembrane helix Transport Zinc Zinc transport MNQPSSLAAD MNQPSSLAADLRGAWHAQAQSHPLITLGLAASAAGVVLLLVAGIVNALTGENRVHVGYAV...
lipoprotein biosynthetic process
plasma membrane
dolichyl-phosphate beta-D-mannosyltransferase activity hydrolase activity N-acyltransferase activity
Mycobacterium bovis
Acyltransferase Cell membrane Hydrolase Membrane Transferase Transmembrane Transmembrane helix
MKLGAWVAAQ
MKLGAWVAAQLPTTRTAVRTRLTRLVVSIVAGLLLYASFPPRNCWWAAVVALALLAWVLTHRATTPVGGLGYGLLFGLVFYVSLLPWIGELVGPGPWLALATTCALFPGIFGLFAVVVRLLPGWPIWFAVGWAAQEWLKSILPFGGFPWGSVAFGQAEGPLLPLVQLGGVALLSTGVALVGCGLTAIALEIEKWWRTGGQGDAPPAVVLPAACICLVLFAAIVVWPQVRHAGSGSGGEPTVTVAVVQGNVPRLGLDFNAQRRAVLDNHVEETLRLAADVHAGLAQQPQFVIWPENSSDIDPFVNPDAGQRISAAAEAIGA...
lipoprotein biosynthetic process plasma membrane dolichyl-phosphate beta-D-mannosyltransferase activity hydrolase activity N-acyltransferase activity Mycobacterium bovis Acyltransferase Cell membrane Hydrolase Membrane Transferase Transmembrane Transmembrane helix MKLGAWVAAQ MKLGAWVAAQLPTTRTAVRTRLTRLVVSIVAGLLLYASFPPRNC...
defense response
amyloplast
hydrolase activity lyase activity
Tulipa gesneriana
Amyloplast Direct protein sequencing Lyase Plant defense Plastid Transit peptide
MSIVSFCSSL
MSIVSFCSSLPAGPHGFKHGRGTRDMVHMPCIVRRTARSPAQACRLLRWNKYHCAAVPTNSSLSPSPTPLDVEIELDLEPFLIKYKSGRIERLGRFGDRTDYVEASLDPATEVTSRDAITDTGVPVRIYLPKVDDSPPNSLRVLVYFHGGAFLVEDSASPPYHNYLNNLASKANILIVSVNYRLAPEYPLPVAYDDCMEALNWVNKHSDGTGQEDWINKHGDFDHLFISGDSAGGNITHNIAMSTDAPKNIEGIALVHPYFFGKVALETELQDPTNLLLHRKLWSFITPESEGLDDPRVNPLGPTAPSLEKIKCKRAVVF...
defense response amyloplast hydrolase activity lyase activity Tulipa gesneriana Amyloplast Direct protein sequencing Lyase Plant defense Plastid Transit peptide MSIVSFCSSL MSIVSFCSSLPAGPHGFKHGRGTRDMVHMPCIVRRTARSPAQACRLLRWNKYHCAAVPTNSSLSPSPTPLDVEIELDLEPFLIKYKSGRIERLGRFGDRTDYVEASLDPATEVTSRDAITDTGVPVRIYLPKVDDSPPNSLRVLVYFH...
cyclic nucleotide biosynthetic process defense response to virus intracellular signal transduction
cytoplasm
adenylate cyclase activity metal ion binding nucleotide binding
Burkholderia cepacia
3D-structure Antiviral defense Cytoplasm Lyase Manganese Metal-binding Nucleotide-binding
MALADDLKKW
MALADDLKKWVGETFTGKWEVQETTSVPNPEDLRLNSNHAKDLKAATVLYADLDGSTDMVNTKKWQFSAQIYKTFLKCASDIIRDEGGNITAYDGDRVMAVFTGNSKNTSAARCALKINSAVLDIIQPAIAKKWQTDFVLRHVVGIDTSQLRTARIGIRGDNDLVWIGRAANYAAKLTNLAGKPTRITADVYNKLADKLKYANGVDMWAPEHWDDMGIWTYTSTWKWTV
cyclic nucleotide biosynthetic process defense response to virus intracellular signal transduction cytoplasm adenylate cyclase activity metal ion binding nucleotide binding Burkholderia cepacia 3D-structure Antiviral defense Cytoplasm Lyase Manganese Metal-binding Nucleotide-binding MALADDLKKW MALADDLKKWVGETFTGKWEVQETT...
negative regulation of cellular respiration
chromosome; cytosol; mitochondrion; nucleus
metal ion binding NAD+ binding NAD-dependent histone decrotonylase activity NAD-dependent protein decrotonylase activity protein-malonyllysine demalonylase activity protein-succinyllysine desuccinylase activity
Fusarium oxysporum f. sp. lycopersici
Chromatin regulator Chromosome Cytoplasm Metal-binding Mitochondrion NAD Nucleus Reference proteome Transferase Transit peptide Zinc
MRLLRPTPRL
MRLLRPTPRLSSIFSSKTATSNLRFFTAMAPHNDVGAFHEALRSSKRILALCGAGLSASSGLPTFRGAGGLWRNHDATSLATLSAFKNDPGLVWLFYNYRRHMCLRAEPNPAHYALAALAEKNKDFLCLTQNVDNLSQQAGHPQDQLRTLHGSLFDIKCTNCDWIQRGNYDDPFCPALAPASVDVEPGKPFPLLDASLPLDPISPDDIPKCPQCKIGFQRPGVVWFGENLDEVMMMGITNWLLEDKVDLMLVIGTSAQVYPAAGYIDKAKRKGARIAVINPEAENEEEMYKVKPGDFAFGKDAAEYLPLLLEPVIGKLET...
negative regulation of cellular respiration chromosome; cytosol; mitochondrion; nucleus metal ion binding NAD+ binding NAD-dependent histone decrotonylase activity NAD-dependent protein decrotonylase activity protein-malonyllysine demalonylase activity protein-succinyllysine desuccinylase activity Fusarium oxysporum f....
cellular response to linoleic acid long-chain fatty acid transport
cytoplasm; nucleus
linoleic acid binding long-chain fatty acid transporter activity oleic acid binding stearic acid binding
Pygoscelis papua
3D-structure Cytoplasm Lipid-binding Nucleus Transport
MCDQFVGTWK
MCDQFVGTWKFLSSENFEDYMKELGVGFATRKMAGVAKPNVTISINGDVITIKTESTFKNTEVSFRLGEEFDETTADDRKTKNVITLDNGILNQVQKWDGKETVIKRKVMDGNLVVECTMNTVTSKRVYERA
cellular response to linoleic acid long-chain fatty acid transport cytoplasm; nucleus linoleic acid binding long-chain fatty acid transporter activity oleic acid binding stearic acid binding Pygoscelis papua 3D-structure Cytoplasm Lipid-binding Nucleus Transport MCDQFVGTWK MCDQFVGTWKFLSSENFEDYMKELGVGFATRKMAGVAKPNVTISIN...
antibacterial innate immune response antifungal innate immune response defense response to fungus defense response to Gram-negative bacterium defense response to Gram-positive bacterium killing of cells of another organism negative regulation of endopeptidase activity suppression of blood coagulation in another organis...
extracellular region
serine-type endopeptidase inhibitor activity
Apis cerana
Antibiotic Antimicrobial Disulfide bond Fungicide Immunity Innate immunity Protease inhibitor Secreted Serine protease inhibitor Signal
MRFQVYILHL
MRFQVYILHLCFFILVVLTYLSQGQSYTTTTTTSTTEQPTFLQKIHETFKKVKENAKIHNLYIFDPPTWIYTTTTEKPVESTENFDITNRQLITVPVRCPPNYDFIKGRCREKIP
antibacterial innate immune response antifungal innate immune response defense response to fungus defense response to Gram-negative bacterium defense response to Gram-positive bacterium killing of cells of another organism negative regulation of endopeptidase activity suppression of blood coagulation in another organis...
cell redox homeostasis cellular response to hydrogen peroxide determination of adult lifespan heat acclimation hydrogen peroxide catabolic process negative regulation of transcription by RNA polymerase II positive regulation of brood size regulation of response to oxidative stress removal of superoxide radicals respons...
cytoplasm; cytosol
thioredoxin peroxidase activity
Caenorhabditis elegans
Alternative splicing Antioxidant Cytoplasm Disulfide bond Oxidoreductase Peroxidase Redox-active center Reference proteome
MSLAPKMSKA
MSLAPKMSKAFIGKPAPQFKTQAVVDGEFVDVSLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRAEEFKAINTVVLAASTDSVFSHLAWINQPRKHGGLGEMNIPVLADTNHQISRDYGVLKEDEGIAFRGLFIIDPSQNLRQITINDLPVGRSVDETLRLVQAFQFVEKHGEVCPAGWTPGSDTIKPGVKESQEYFKKH
cell redox homeostasis cellular response to hydrogen peroxide determination of adult lifespan heat acclimation hydrogen peroxide catabolic process negative regulation of transcription by RNA polymerase II positive regulation of brood size regulation of response to oxidative stress removal of superoxide radicals respons...
canonical Wnt signaling pathway embryo development ending in birth or egg hatching embryonic digestive tract morphogenesis embryonic morphogenesis endodermal cell fate specification engulfment of apoptotic cell establishment of mitotic spindle orientation gastrulation interneuron migration left/right axis specification...
early endosome; plasma membrane
Wnt receptor activity Wnt-protein binding
Caenorhabditis elegans
Alternative splicing Cell membrane Developmental protein Disulfide bond Endosome Glycoprotein Membrane Receptor Reference proteome Signal Transmembrane Transmembrane helix Wnt signaling pathway
MHRHILILFL
MHRHILILFLFGCLSADQRLSSTSISSMNGFSTTRKCEHITIPMCKNLDYNQTVFPNLLGHTTQSEAGPAIAQFNPLIKVKCSEDIRLFLCTVYAPVCTVLEKPIQPCRELCLSAKNGCESLMKKFGFQWPDQLDCNKFPVTDLCVGKNSSESSNSKNYRSSNDVTFGVSTIANEVVLSPKKCPHHMHTTSGSHFSLPLLSGRLPECSLTCEADNQVPMMFDGRVRRILRIWTAAWSVACFVCSLFTLVTFLVDLSRFAYPVRPILYLAFCYLAISTVYMIGVVGEDGFACGTYGSTPTTLVTQGGENVGCSALAVVHYF...
canonical Wnt signaling pathway embryo development ending in birth or egg hatching embryonic digestive tract morphogenesis embryonic morphogenesis endodermal cell fate specification engulfment of apoptotic cell establishment of mitotic spindle orientation gastrulation interneuron migration left/right axis specification...
cellular response to organic substance xenobiotic catabolic process
extracellular region
acetylesterase activity carboxylic ester hydrolase activity
Ideonella sakaiensis
3D-structure Disulfide bond Hydrolase Reference proteome Secreted Serine esterase Signal
MNFPRASRLM
MNFPRASRLMQAAVLGGLMAVSAAATAQTNPYARGPNPTAASLEASAGPFTVRSFTVSRPSGYGAGTVYYPTNAGGTVGAIAIVPGYTARQSSIKWWGPRLASHGFVVITIDTNSTLDQPSSRSSQQMAALRQVASLNGTSSSPIYGKVDTARMGVMGWSMGGGGSLISAANNPSLKAAAPQAPWDSSTNFSSVTVPTLIFACENDSIAPVNSSALPIYDSMSRNAKQFLEINGGSHSCANSGNSNQALIGKKGVAWMKRFMDNDTRYSTFACENPNSTRVSDFRTANCS
cellular response to organic substance xenobiotic catabolic process extracellular region acetylesterase activity carboxylic ester hydrolase activity Ideonella sakaiensis 3D-structure Disulfide bond Hydrolase Reference proteome Secreted Serine esterase Signal MNFPRASRLM MNFPRASRLMQAAVLGGLMAVSAAATAQTNPYARGPNPTAASLEASAGPF...
cellular response to organic substance xenobiotic catabolic process
cell outer membrane
carboxylic ester hydrolase activity metal ion binding
Ideonella sakaiensis
3D-structure Calcium Cell outer membrane Disulfide bond Hydrolase Lipoprotein Membrane Metal-binding Palmitate Reference proteome Serine esterase Signal
MQTTVTTMLL
MQTTVTTMLLASVALAACAGGGSTPLPLPQQQPPQQEPPPPPVPLASRAACEALKDGNGDMVWPNAATVVEVAAWRDAAPATASAAALPEHCEVSGAIAKRTGIDGYPYEIKFRLRMPAEWNGRFFMEGGSGTNGSLSAATGSIGGGQIASALSRNFATIATDGGHDNAVNDNPDALGTVAFGLDPQARLDMGYNSYDQVTQAGKAAVARFYGRAADKSYFIGCSEGGREGMMLSQRFPSHYDGIVAGAPGYQLPKAGISGAWTTQSLAPAAVGLDAQGVPLINKSFSDADLHLLSQAILGTCDALDGLADGIVDNYRAC...
cellular response to organic substance xenobiotic catabolic process cell outer membrane carboxylic ester hydrolase activity metal ion binding Ideonella sakaiensis 3D-structure Calcium Cell outer membrane Disulfide bond Hydrolase Lipoprotein Membrane Metal-binding Palmitate Reference proteome Serine esterase Signal MQTT...
regulation of floral organ abscission regulation of flower development regulation of seed development response to cold seed abscission
nucleus; transcription regulator complex
DNA-binding transcription factor activity transcription cis-regulatory region binding
Oryza sativa subsp. japonica
DNA-binding Nucleus Reference proteome Repeat Transcription Transcription regulation
MWDLNDSPAA
MWDLNDSPAAEAAPPPLSPSADDSGASSSSAAAVVEIPDDADDDSAAVVVVTRQFFPPAVPGGGGDPAPGNARAGWLRLAGAAPPVAATGPAASAAVSKKSRRGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLGGFDTAHAAARAYDRAAIKFRGVEADINFSLEDYEDDLKQMSNLTKEEFVHVLRRQSTGFPRGSSKYRGVTLHKCGRWEARMGQFLGKKYVYLGLFDTEEEAARAYDRAAIKCNGKDAVTNFDPSIYAGEFEPPAAATGDAAEHNLDLSLGSSAGSKRGNVDGGGDDEITGGGGGGAGSDQRV...
regulation of floral organ abscission regulation of flower development regulation of seed development response to cold seed abscission nucleus; transcription regulator complex DNA-binding transcription factor activity transcription cis-regulatory region binding Oryza sativa subsp. japonica DNA-binding Nucleus Reference...
collagen catabolic process determination of heart left/right asymmetry determination of left/right symmetry embryonic heart tube left/right pattern formation extracellular matrix organization proteolysis regulation of heart looping
extracellular matrix
metalloendopeptidase activity zinc ion binding
Danio rerio
Calcium Disulfide bond Glycoprotein Hydrolase Metal-binding Metalloprotease Protease Reference proteome Repeat Signal Zinc
MLTVIRRIFI
MLTVIRRIFIIQTFIFITAEKIFHSRDHSDVLNNIHQAELITDTDTAQRFLSKYGFIKAAGSEESQLSESSGDLDFSLSLDLHEGGTTSGSSSSDLQFVSALRDFQRLSDLPVTGVFDDATKAAMNKPRCGVMDDDQELKDVTGSNSTRNHIRTSTNTSHNHEHQAPVRKKRHLSALLKNTSLQKRDVSKWTGHMAFSKSVLKWRLIGEGYSSQLSIQEQKYIFRLAFRMWSEISPLQFIEDLHSPLENIDIRLGFGTGRHLGCSQRFDGAGREFAHAWFLGDIHFDDDEHFTVPNTGSGISLLKVAVHEIGHVLGLPHI...
collagen catabolic process determination of heart left/right asymmetry determination of left/right symmetry embryonic heart tube left/right pattern formation extracellular matrix organization proteolysis regulation of heart looping extracellular matrix metalloendopeptidase activity zinc ion binding Danio rerio Calcium...
negative regulation of JNK cascade negative regulation of MAPK cascade negative regulation of p38MAPK cascade peptidyl-serine O-acetylation peptidyl-threonine O-acetylation
extracellular region
O-acetyltransferase activity toxin activity
Yersinia pseudotuberculosis
Acyltransferase Allosteric enzyme Plasmid Secreted Transferase Virulence
MIGPISQINI
MIGPISQINISGGLSEKETSSLISNEELKNIITQLETDISDGSWFHKNYSRMDVEVMPALVIQANNKYPEMNLNLVTSPLDLSIEIKNVIENGVRSSRFIINMGEGGIHFSVIDYKHINGKTSLILFEPANFNSMGPAMLAIRTKTAIERYQLPDCHFSMVEMDIQRSSSECGIFSFALAKKLYIERDSLLKIHEDNIKGILSDGENPLPHDKLDPYLPVTFYKHTQGKKRLNEYLNTNPQGVGTVVNKKNETIVNRFDNNKSIVDGKELSVSVHKKRIAEYKTLLKV
negative regulation of JNK cascade negative regulation of MAPK cascade negative regulation of p38MAPK cascade peptidyl-serine O-acetylation peptidyl-threonine O-acetylation extracellular region O-acetyltransferase activity toxin activity Yersinia pseudotuberculosisAcyltransferase Allosteric enzyme Plasmid Secreted Tran...
defense response to bacterium defense response to oomycetes pollen aperture formation pollen development protein autophosphorylation
cytosol; plasma membrane; pollen aperture
ATP binding carbohydrate binding kinase activity protein serine/threonine kinase activity
Oryza sativa subsp. japonica
ATP-binding Cell membrane Cytoplasm Glycoprotein Kinase Lectin Membrane Nucleotide-binding Phosphoprotein Reference proteome Serine/threonine-protein kinase Signal Transferase Transmembrane Transmembrane helix
MPPRCRRLPL
MPPRCRRLPLLFILLLAVRPLSAAAASSIAAAPASSYRRISWASNLTLLGSASLLPGAAGVALTTPSRDGVGAGRALFSEPVRLLLPQDAAASASASRAATPASFSTRFTFRITPSPTYGDGLAFLLTSSRTFLGASNGFLGLFPSSSASDEGELRDVSTVAVEIDTHLDVALHDPDGNHVALDAGSIFSVASAQPGVDLKAGVPITAWVEYRAPRRRLNVWLSYSPSRRPEKPALSADVDLSGLLRTYMYAGFSASNGNGAALHVVERWTFRTFGFPNSSYAPPPTKYIGPMPPNNQPLPPPPSPSPSPPPPSPPPPPH...
defense response to bacterium defense response to oomycetes pollen aperture formation pollen development protein autophosphorylation cytosol; plasma membrane; pollen aperture ATP binding carbohydrate binding kinase activity protein serine/threonine kinase activity Oryza sativa subsp. japonica ATP-binding Cell membrane ...
cell cycle cell division DNA recombination regulation of endosperm development regulation of mitotic sister chromatid separation
chromosome; cytoplasm
ATP binding ATP-dependent chromatin remodeler activity DNA translocase activity helicase activity hydrolase activity
Oryza sativa subsp. japonica
ATP-binding Cell cycle Cell division Chromosome Cytoplasm DNA recombination Helicase Hydrolase Mitosis Nucleotide-binding Reference proteome
MASPPPFDIC
MASPPPFDICGDLDDDPTPPAPTPLAAPTPNGLNDRLLRLTRTHQRGPSQNPNPNPNPNPKPPPPPPPQEPEPAKVKLAGRRRLCKLSTAGDESAGDDDSIRDILDDLTTRLDSLSVDRPTARPRPHVSPLPCALHADPDPSQSQLNDGTKPSSSFVDCDDDDDDAGGAYGGFGVKEEVTRKVFKASSSFGGRGNDDKMKAKGAYAFDTVSRKTTTESKASKFFGDYDDEDDIDQDAENGKENHADDVGWEKTEDFKMEPTGTGVTRKPYNLPGRIFNMLYPHQREGLRWLWVLHCRGTGGILGDDMGLGKTMQVSAFLA...
cell cycle cell division DNA recombination regulation of endosperm development regulation of mitotic sister chromatid separation chromosome; cytoplasm ATP binding ATP-dependent chromatin remodeler activity DNA translocase activity helicase activity hydrolase activity Oryza sativa subsp. japonica ATP-binding Cell cycle ...
innate immune response phosphorylation
plasma membrane
ATP binding chitin binding protein serine kinase activity protein serine/threonine kinase activity transmembrane receptor protein kinase activity
Oryza sativa subsp. japonica
3D-structure ATP-binding Cell membrane Chitin-binding Disulfide bond Glycoprotein Immunity Innate immunity Kinase Membrane Nucleotide-binding Plant defense Receptor Reference proteome Serine/threonine-protein kinase Signal Transferase Transmembrane Transmembrane helix
MEASTSLLVL
MEASTSLLVLVLAAAAFAAGTVTEAAGDGCSAGCDLALASFYVTPNQNVTNMADLFGIGAANYRSLAPYNPNIPNLDFINVGGRVNVYFTCGCRSLPGSPGATYLAGAFPFQMSRGQIYTSVAANYNNLTTAEWLQATNSYPANNIPDTAVINATVNCSCGDASISPDYGLFLTYPLRAEDTLASVAATYGLSSQLDVVRRYNPGMESATGSGIVYIPVKDPNGSYLPLKSPGKGASAGAIAGGVVAGVVVLAAIFLYIIFYRRRKAKQATLLQSSEDSTQLGTISMDKVTPSTIVGPSPVAGITVDKSVEFSYEELSNA...
innate immune response phosphorylation plasma membrane ATP binding chitin binding protein serine kinase activity protein serine/threonine kinase activity transmembrane receptor protein kinase activity Oryza sativa subsp. japonica 3D-structure ATP-binding Cell membrane Chitin-binding Disulfide bond Glycoprotein Immunity...
fatty acid metabolic process sphingolipid metabolic process
extracellular region; lysosome
ceramidase activity fatty acid amide hydrolase activity N-acylsphingosine amidohydrolase activity
Heterocephalus glaber
3D-structure Disulfide bond Glycoprotein Hydrolase Lipid metabolism Lysosome Secreted Signal Sphingolipid metabolism Zymogen
MLGRSRLTFV
MLGRSRLTFVLLAAAVTCAEAQHAPPWTEDCRKSTYPPSGPTYRGPVPWYTINLDLPPYKRWHELMVDKGPMLKIIVNSFKNMVNTFVPSGKVMQMVDQKLPDLLGQFSGPYEEEMKGIADVTEIPLGEIISFNIFYELFTMCTSIITEDKKGHLLHVRNMDFGIFLGWNINNNTWVITEELKPLTVNLDFQRNSKTVFKATSFAGYVGMLTGFKPGQFSLTLNERFSMNGGYLGLLEWILGKKDASWIGFITRSVLENATSYEEAKNILAKTKLLAPAYFILGGNQSGEGCVITRERKDSLDIYELDPKQGRWYVVQTN...
fatty acid metabolic process sphingolipid metabolic process extracellular region; lysosome ceramidase activity fatty acid amide hydrolase activity N-acylsphingosine amidohydrolase activity Heterocephalus glaber 3D-structure Disulfide bond Glycoprotein Hydrolase Lipid metabolism Lysosome Secreted Signal Sphingolipid met...
angiogenesis cell adhesion heart development heterotypic cell-cell adhesion killing of cells of another organism leukocyte chemotaxis involved in inflammatory response muscle cell differentiation positive regulation of inflammatory response positive regulation of toll-like receptor 4 signaling pathway programmed cell d...
plasma membrane; synaptic membrane
cell adhesion mediator activity lipopolysaccharide binding membrane destabilizing activity
Danio rerio
Angiogenesis Cell adhesion Cell membrane Cytolysis Glycoprotein Inflammatory response Membrane Reference proteome Synapse Transmembrane Transmembrane helix
MASEAMELNG
MASEAMELNGGVNRRDDPGARPQQGRMSRNTPLNMNHYANKKSAAESMLDIALLMANASQLKTVLELGPSFSFYIPLITLISISLTLQIIVGILLIFIVKWNLNDSSKHYILNLLENIVTALVFIVVVVNVFITAFGVQRPDDKTS
angiogenesis cell adhesion heart development heterotypic cell-cell adhesion killing of cells of another organism leukocyte chemotaxis involved in inflammatory response muscle cell differentiation positive regulation of inflammatory response positive regulation of toll-like receptor 4 signaling pathway programmed cell d...
axonogenesis mRNA processing RNA splicing
axon; cytoplasm; dendrite; growth cone; perikaryon; protein-containing complex; ribonucleoprotein complex
RNA binding
Danio rerio
Cell projection Cytoplasm mRNA processing mRNA splicing Reference proteome Repeat RNA-binding
MFEISRTLNA
MFEISRTLNAALLSNEGSTETQWRQADLPQLQGWAEKGLLTQPKMIISNMEPQVTNGPNSATANGPSSNSRSCPSPMQTGGSNDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGPTGGSRGVGFIRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNPSQKTSQALLSQLYQSPNRRYPGPLHHQAQRFRLDNLLNMAYGVKRFSPITIDSMTSLVGMNI...
axonogenesis mRNA processing RNA splicing axon; cytoplasm; dendrite; growth cone; perikaryon; protein-containing complex; ribonucleoprotein complex RNA binding Danio rerio Cell projection Cytoplasm mRNA processing mRNA splicing Reference proteome Repeat RNA-binding MFEISRTLNA MFEISRTLNAALLSNEGSTETQWRQADLPQLQGWAEKGLLTQ...
mRNA methylation positive regulation of translation
nucleus
mRNA (2'-O-methyladenosine-N6-)-methyltransferase activity RNA polymerase II C-terminal domain binding S-adenosyl-L-methionine binding
Danio rerio
3D-structure Methyltransferase Nucleus Reference proteome Transferase
MTSENHTTIK
MTSENHTTIKADSALVMSPTGSTSQAAPFSPSTSKPIQELPDELIQAGWSKCWSKRENRPYYFNRFTNQSLWEMPVLGQHDVISDPLGLNAAPASGEANADAGLGNGQRKRHPSEDASQAGPNSFKRPKVEIPATPTTPTVPISPSTPGVKPWVNTTTDEKQGQASTPAPAPYRPSVVYWDLDIQTNAVIRERAPADHLPPHPEIELQRAQLTTKLRQHYHELCSQREGIEPPRESFNRWLLERKVVDKGLDPLLPSECDPVISPSMFREIMNDIPIRLSRIKYKEEARKLLFKYAEAAKKMIDSRNATPESRKVVKWNV...
mRNA methylation positive regulation of translation nucleus mRNA (2'-O-methyladenosine-N6-)-methyltransferase activity RNA polymerase II C-terminal domain binding S-adenosyl-L-methionine binding Danio rerio 3D-structure Methyltransferase Nucleus Reference proteome Transferase MTSENHTTIK MTSENHTTIKADSALVMSPTGSTSQAAPFSP...
blood vessel maturation canonical Wnt signaling pathway dorsal root ganglion development extracellular matrix organization negative regulation of metalloendopeptidase activity regulation of angiogenesis regulation of canonical Wnt signaling pathway regulation of cell cycle regulation of cell migration involved in sprou...
plasma membrane; side of membrane; Wnt signalosome
coreceptor activity endopeptidase inhibitor activity metalloendopeptidase inhibitor activity serine-type endopeptidase inhibitor activity
Danio rerio
Cell membrane Disulfide bond Glycoprotein GPI-anchor Lipoprotein Membrane Protease inhibitor Reference proteome Repeat Serine protease inhibitor Signal Wnt signaling pathway
MSGCLQILTV
MSGCLQILTVLLCCRFWALVFSQDQSCCVHHAADIPRCRDACEQLASIRSESRLRHLLHRLPSYCPETLSELWICINNSLPGASRKSDGWVGLGCCELAISAECRRDCKQASSKNDISKVCKKDTENPLYSCITKNEMGSVCCSYAGRHTTCREYCQAIFRTDSSPTVSQISAVKEYCQSVSPPLILCVENYTRLHPTHRPIDSLHCCDRAEEAHCQLACKRILRTLSTEQEIMDGLISECGSQPLPQDPLWQCFLGSAHPPANTDPESPPIAKMDSAKLHCCFKANTSICRNMCVEISTSWGTQSWQEFDQHCEYNPVE...
blood vessel maturation canonical Wnt signaling pathway dorsal root ganglion development extracellular matrix organization negative regulation of metalloendopeptidase activity regulation of angiogenesis regulation of canonical Wnt signaling pathway regulation of cell cycle regulation of cell migration involved in sprou...
cell cycle cell division cilium assembly dephosphorylation microtubule cytoskeleton organization positive regulation of cytokinesis regulation of exit from mitosis
centrosome; cytoplasm; kinocilium; mitotic spindle; nucleolus; spindle pole
myosin phosphatase activity protein serine/threonine phosphatase activity protein tyrosine phosphatase activity protein tyrosine/serine/threonine phosphatase activity
Danio rerio
Cell cycle Cell division Cell projection Cytoplasm Cytoskeleton Hydrolase Nucleus Phosphoprotein Protein phosphatase Reference proteome
MTLDNLKHSA
MTLDNLKHSAILSTLFKMADDNDLLGASEFIKDRLYFATLRSKPKSTANTHYFSTDEEFVYENFYADFGPLNLAMLYRYCCKLNKKLKSFTLTRKRIVHYTSFDQRKRANAAVLIGAYAVIYLKKTPEEAYRALISGSNASYLPFRDASFGNCTYNLTVLDCLQGIRKALQHGFLNFETFDVNEYEHYERVENGDLNWITPGKLLAFSGPHPKSKVENGYPLHAPEAYFPYFRKHNVTTIVRLNKKIYDAKRFTDAGFDHYDLFFVDGSTPSDIITRRFLHICESTSGAVAVHCKAGLGRTGTLIGCYLMKHYRFTSAEA...
cell cycle cell division cilium assembly dephosphorylation microtubule cytoskeleton organization positive regulation of cytokinesis regulation of exit from mitosis centrosome; cytoplasm; kinocilium; mitotic spindle; nucleolus; spindle pole myosin phosphatase activity protein serine/threonine phosphatase activity protei...
cholesterol homeostasis digestion lipid metabolic process lipid transport lipoprotein biosynthetic process lipoprotein metabolic process lipoprotein transport long-chain fatty acid transport medium-chain fatty acid transport plasma lipoprotein particle assembly protein secretion sprouting angiogenesis
basolateral plasma membrane; endoplasmic reticulum; Golgi apparatus
lipid binding lipid transfer activity lipid transporter activity phosphatidylethanolamine transfer activity phospholipid transporter activity
Danio rerio
Disulfide bond Endoplasmic reticulum Glycoprotein Golgi apparatus Lipid transport Lipid-binding Reference proteome Signal Transport
MMPVAGLLLC
MMPVAGLLLCVTAVLCTSALGAGPRLDNGKLYRYSYSTEVGLNRPTGSPGGNVGFRISSDVDINLAWRNPEIQDEQLLQVKISNIQVESAGKHSRKNNIFHGSSAESILGKVRLEALQRPFLVLWKMGKIRSLYAQKAEPATVKNLKRGVASMLMMQLKSGKMSEADASGKCLVEYKVNKHQVIRTKHLETCKSQETGFTTHSPVLGISGKCAAETVITLENGIIKSADAKETHVLSINARHKAATKVLSRQSLTLKAIEAGPAEVAGKDVAGVVKALDDKFLSVGVIVEKTKPKCKGCPNLMETWKAVRSQLEPNSLSK...
cholesterol homeostasis digestion lipid metabolic process lipid transport lipoprotein biosynthetic process lipoprotein metabolic process lipoprotein transport long-chain fatty acid transport medium-chain fatty acid transport plasma lipoprotein particle assembly protein secretion sprouting angiogenesis basolateral plasm...
bone morphogenesis chromatin remodeling epigenetic regulation of gene expression heart development histone succinylation internal peptidyl-lysine acetylation limb development long-term memory peptidyl-lysine glutarylation positive regulation of cytokine production positive regulation of DNA-templated transcription posi...
ATAC complex; centrosome; cytoplasm; histone acetyltransferase complex; nucleus
chromatin binding histone acetyltransferase activity histone glutaryltransferase activity histone H3 acetyltransferase activity histone H3K9 acetyltransferase activity histone succinyltransferase activity peptide-lysine-N-acetyltransferase activity transcription coactivator activity
Danio rerio
Acyltransferase Bromodomain Chromosome Cytoplasm Cytoskeleton Nucleus Reference proteome Transcription Transcription regulation Transferase
MADPAAQSSA
MADPAAQSSAQPRLQQAQSSGPTGSNSNPGAGSSDPARPGLSQQQWSSQKKAQVRSFPRAKKLEKLGVFSSCKANDACKCNGWKNPNPPTAARMELQQQAASLTETCRSCGHSLAEHVSHLENVSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMGKPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPKERQTMYELSKMFLLCLNYWKLETPSQFRQRAQKEDAAAYKVDYTRWLCYCHVPQSNDSLPRYETCQVFGRSLLKSIFTVTRRQLLEKFRVEKDKLPPEKRTLILTHFPKFL...
bone morphogenesis chromatin remodeling epigenetic regulation of gene expression heart development histone succinylation internal peptidyl-lysine acetylation limb development long-term memory peptidyl-lysine glutarylation positive regulation of cytokine production positive regulation of DNA-templated transcription posi...
lens fiber cell differentiation lipid catabolic process N-acylphosphatidylethanolamine metabolic process organelle disassembly
cytoplasm; cytosol; endoplasmic reticulum; endoplasmic reticulum membrane; lysosomal membrane; lysosome; mitochondrial membrane; mitochondrion
N-acyltransferase activity phospholipase A1 activity phospholipase A2 activity
Danio rerio
Cytoplasm Endoplasmic reticulum Hydrolase Lipid degradation Lipid metabolism Lysosome Membrane Mitochondrion Reference proteome Transferase Transmembrane Transmembrane helix
MDNQQRRTDN
MDNQQRRTDNMASGETDHLQCVEEPQPGDLIEIFRPAYQHWALYLGDGYIINLTPVDEGQATAVSSVKSVFSRKAVVRMQLLKEVVGADSYRINNKYDDDHTPLPVSEIIQRAQMLIGQEVSYDLLGSNCEHFVTLLRYGEGVSEQASRAIGAISLVTAAASAFSVLGLINTRSRNRPF
lens fiber cell differentiation lipid catabolic process N-acylphosphatidylethanolamine metabolic process organelle disassembly cytoplasm; cytosol; endoplasmic reticulum; endoplasmic reticulum membrane; lysosomal membrane; lysosome; mitochondrial membrane; mitochondrion N-acyltransferase activity phospholipase A1 activi...
L-proline biosynthetic process phosphorylation
cytoplasm
ATP binding glutamate 5-kinase activity identical protein binding
Leishmania donovani
Amino-acid biosynthesis ATP-binding Kinase Magnesium Nucleotide-binding Proline biosynthesis Transferase
MADILKSVKR
MADILKSVKRIVVKVGSSILVDNQEIAAHRIEALCQFIADLQTKYEVILVTSGAVAAGYTKKEMDKSYVPNKQALASMGQPLLMHMYYTELQKHGILCAQMLLAAYDLDSRKRTINAHNTIEVLISHKVIPIINENDATALEELVFGDNDRLSALVAHHFKANLLVILSDIDGYYTENPRTSTNATIRSVVHELSPDDLVAEATPNNRFATGGIVTKLQAAQFLLERGGKMYLSSGFHLEKARQFLLGGSHEIGTLFYSRVSS
L-proline biosynthetic process phosphorylation cytoplasm ATP binding glutamate 5-kinase activity identical protein binding Leishmania donovaniAmino-acid biosynthesis ATP-binding Kinase Magnesium Nucleotide-binding Proline biosynthesis Transferase MADILKSVKR MADILKSVKRIVVKVGSSILVDNQEIAAHRIEALCQFIADLQTKYEVILVTSGAVAAGYTKK...
circadian rhythm green leaf volatile biosynthetic process lignin biosynthetic process methylation phenylpropanoid metabolic process
cytosol
caffeoyl CoA:S-adenosyl-L-methionine O-methyltransferase activity caffeoyl-CoA O-methyltransferase activity metal ion binding
Petunia hybrida
Cytoplasm Lignin biosynthesis Metal-binding Methyltransferase S-adenosyl-L-methionine Transferase
MAENGAAVQE
MAENGAAVQENQNVIRHQEVGHKSLLQSDALYQYILETSVYPREPESMKELRELTAKHPWNLMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPHDGKILAMDINRENYEIGLPVIEKAGVAHKIDFREGPALPVLDQLVEDKNNHGTYDFIFVDADKDNYINYHKRIIDLVKVGGLIGYDNTLWNGSLVAPADTPMRKYVRYYRDFILELNKALAADPRIEICMLPVGDGITLGRRIS
circadian rhythm green leaf volatile biosynthetic process lignin biosynthetic process methylation phenylpropanoid metabolic process cytosol caffeoyl CoA:S-adenosyl-L-methionine O-methyltransferase activity caffeoyl-CoA O-methyltransferase activity metal ion binding Petunia hybrida Cytoplasm Lignin biosynthesis Metal-bi...
proteolysis
extracellular region
potassium channel regulator activity serine-type endopeptidase activity toxin activity
Crotalus durissus collilineatus
Blood coagulation cascade activating toxin Direct protein sequencing Disulfide bond Hemostasis impairing toxin Hydrolase Ion channel impairing toxin Potassium channel impairing toxin Protease Secreted Serine protease Toxin Voltage-gated potassium channel impairing toxin
VIGGDECNIN
VIGGDECNINEHNFLVALYEYWSQSFLCGGTLINGEWVLTAAHCDRKHILIYVGVHDRSVQFDKEQRRFPKEKYFFNCRNNFTKWDKDIMLIRLNKPVSYSEHIAPLSLPSSPPIVGSVCRVMGWGTIKSPQETLPDVPHCANINLLDYEVCRTAHPQFRLPATIRILCAGVLEGGIDTCHRDSGGPLICNGEFQGIVSWGDGSCAQPDKPALYSKVFDHLDWIQNIIAGSETVNCPS
proteolysis extracellular region potassium channel regulator activity serine-type endopeptidase activity toxin activity Crotalus durissus collilineatus Blood coagulation cascade activating toxin Direct protein sequencing Disulfide bond Hemostasis impairing toxin Hydrolase Ion channel impairing toxin Potassium channel i...
response to herbivore response to insect response to jasmonic acid response to salicylic acid terpenoid biosynthetic process
chloroplast
geranylfarnesyl diphosphate synthase activity metal ion binding transferase activity
Leucosceptrum canum
Chloroplast Isoprene biosynthesis Magnesium Metal-binding Plastid Transferase Transit peptide
MSHCTIFLYK
MSHCTIFLYKYFPGKPRYQHCSFLHPLNHKLKSLFLPITGSRFLSNSTFSVSDSAHSHQAKPHVRNAQFDFKAYMLEKITAVNQALDAALPVREPVKIHEAMRYSLLLGGKRICPIVCLAACHLVGGDESTAMPSAAALEMIHAMSLMHDDLPCMDNDDLRRGRPSNHVVFGEGATVLAGYALIARAFEHIATATQGVGPGKILRVIGELAQLIGAEGVVGGQVVDLRCGGEGQMAIGLEQLEYIHLHKTAASVEASAVAGAVLGGASEEEIERLRKYSRSAGLLFQVVDDILDVTKSSEELGKTAGKDLAAGKTTYPKL...
response to herbivore response to insect response to jasmonic acid response to salicylic acid terpenoid biosynthetic process chloroplast geranylfarnesyl diphosphate synthase activity metal ion binding transferase activity Leucosceptrum canum Chloroplast Isoprene biosynthesis Magnesium Metal-binding Plastid Transferase...
cellular detoxification of cadmium ion heme metabolic process heme transmembrane transport porphyrin-containing compound metabolic process
early endosome membrane; endolysosome membrane; endoplasmic reticulum membrane; extracellular region; Golgi apparatus; Golgi membrane; lysosomal membrane; melanosome membrane; mitochondrial outer membrane; multivesicular body membrane; plasma membrane
ABC-type heme transporter activity ABC-type transporter activity ATP binding ATP hydrolysis activity
Mesocricetus auratus
ATP-binding Cell membrane Disulfide bond Endoplasmic reticulum Endosome Glycoprotein Golgi apparatus Lysosome Membrane Mitochondrion Mitochondrion outer membrane Nucleotide-binding Reference proteome Secreted Translocase Transmembrane Transmembrane helix Transport
MVTVGNYCEA
MVTVGNYCEAEGPLGPAWAQNGLSPCFFFTLVPSTLMALGALALVLVLPCRRRDVPSGTEELFWAADSRVAPYALQLFLATLQVALPLAGLAGRVGTARGVRLPGYLLLASMLGSLASACGLWLLVAERRQARQSLAMGVWMKFRHSSGLLLLWTVAFAAENLALVSWNSPQWWWARADLGQQVQFGLWVLRYVISGGLFILGLWAPGLRPQSYTLRVHEADQDVERNQAQSTDRTSTWRDLGRKLRLLSSYLWPRGSPALQFIVLICLGLMGLDRALNVLVPIFYRDIVNLLTSKAPWSSLAWTVTTYVFLKFLQGGGT...
cellular detoxification of cadmium ion heme metabolic process heme transmembrane transport porphyrin-containing compound metabolic process early endosome membrane; endolysosome membrane; endoplasmic reticulum membrane; extracellular region; Golgi apparatus; Golgi membrane; lysosomal membrane; melanosome membrane; mitoc...
determination of adult lifespan innate immune response magnesium ion homeostasis magnesium ion transport positive regulation of gonad development positive regulation of multicellular organism growth positive regulation of vulval development response to magnesium ion
basolateral plasma membrane; plasma membrane
transmembrane transporter activity
Caenorhabditis elegans
Alternative splicing CBS domain Cell membrane Glycoprotein Ion transport Membrane Reference proteome Repeat Signal Transmembrane Transmembrane helix Transport
MSKTPWALGL
MSKTPWALGLLIFLLTFTSPLSSSPVRSTDNSTSSKGLLNVNSSVILEPSILPSSASKPESLHLSKVRVSGLRLEAHASSTENIVLGHNKKHNVVVVPNKNVRVVLFGQNFQDIGALTFTADGSCKDLAHFFEADFSSMTPIRVVVEMSFPKTTESKDSFKLCVSEKFYANPQFVIVEDPFTMVTTEIPPVDEYMPKWLSWICLLILLCFSGLFSGLNLGLMTLSPYELQLYIASGTEQEKRDAGRILPIRKKGNQLLCTLLIGNVVVNVGVSLLMDQLVGSGFAVLVAATSCIVVFGEIIPQALCVKLGLPIGARTIPI...
determination of adult lifespan innate immune response magnesium ion homeostasis magnesium ion transport positive regulation of gonad development positive regulation of multicellular organism growth positive regulation of vulval development response to magnesium ion basolateral plasma membrane; plasma membrane transmem...
IMP catabolic process inosine salvage nicotinamide riboside biosynthetic process nicotinic acid riboside biosynthetic process
cytoplasm
ATP binding IMP 5'-nucleotidase activity magnesium ion binding
Plasmodium falciparum
3D-structure Allosteric enzyme ATP-binding Cytoplasm Hydrolase Magnesium Metal-binding Nucleotide metabolism Nucleotide-binding Reference proteome
MKNLDINTFD
MKNLDINTFDNIEDIPLGSSEQDPYDFFTLSDRNVMNSDMKKNIVQWNSRYSYNQLKNKDSLIMFLVEIFRSLFVSNCIDKNIDNVLLSIEEMFIDHYYNPQHSRLKYLIDDVGIFFTKLPITKAFHTYNKKYRITKRLYAPPTFNEVRHILNLAQILSLEEGLDLLTFDADETLYPDGHDFNDEVLASYISCLLKKMNIAIVTAASYNNDAEKYQKRLENLLKYFSKHNIKDGSYKNFYVMGGESNYLFKCNEEATLYSVPENEWRHYKKFVDYDTVQEILNISEKCLEKVIKDFGLCAQIQRKEKSIGLVPNKIPSLN...
IMP catabolic process inosine salvage nicotinamide riboside biosynthetic process nicotinic acid riboside biosynthetic process cytoplasm ATP binding IMP 5'-nucleotidase activity magnesium ion binding Plasmodium falciparum 3D-structure Allosteric enzyme ATP-binding Cytoplasm Hydrolase Magnesium Metal-binding Nucleotide m...
hemoglobin catabolic process proteolysis
cytoplasm; food vacuole; vacuolar lumen
manganese ion binding metalloaminopeptidase activity
Plasmodium falciparum
3D-structure Aminopeptidase Cytoplasm Hydrolase Manganese Metal-binding Protease Reference proteome Signal Vacuole
MQLNFLLFVF
MQLNFLLFVFIFLMVFHLNIFNKGKRQNLVSAYLNHFKKSYFSGVTSGSDCVNKSEVSSDNNNNNNNNNNKIAHNFFSKKYQRNFENNNLSENQENNKNIIYSGSNIFKNIYNTEMMSNNNTVDVNMMDNNPAARLEELRTIMKKNKIDVYILINSDEHNSEIINEKDKKIVKITNYSGADGILIVTKDKPILYVNALYELQAMNELDQNLFTLRISRIDNRDEIFETISSLEFNTIAFDGKNTSVVFYEKLRKALLNAYPKKKIVEKIIYNNNFDDVNKKDDENVLNFLVLEKSLVEIKDYPVNNKTLYIHDRKYNGAC...
hemoglobin catabolic process proteolysis cytoplasm; food vacuole; vacuolar lumen manganese ion binding metalloaminopeptidase activity Plasmodium falciparum 3D-structure Aminopeptidase Cytoplasm Hydrolase Manganese Metal-binding Protease Reference proteome Signal Vacuole MQLNFLLFVF MQLNFLLFVFIFLMVFHLNIFNKGKRQNLVSAYLNHFK...
arbuscular mycorrhizal association regulation of DNA-templated transcription response to symbiotic fungus
cytoplasm; nucleus
protein homodimerization activity
Lotus japonicus
Cytoplasm Nucleus Transcription Transcription regulation
MINSMCGSSV
MINSMCGSSVSLKSENSRNKPQPTSPNESVLQSKKNATQSSADLEQTSLNLTPPSLNLPALKFDLDGDVEVQSPDSSMWESFFSDHLLDGDFMISSPVRNNVPSPQASTFNSNYNYAHQGIQSQSLSGCSPPRFSSPLGAFNSNKGKGLSPLHRVFNSPNNQYMQHVENLALPAIEEFLEEYQGDHGLGGGGGYSNSSNKVSSDIGSSSECFDMQNHIPSMLDSLTMQNSSRYCGSVSEDSSVHGGSSQLSQDSDFYHQMGSMASASLSQALQQERYQEKQQKQHQTQQQQQPQQQQQNLTVPIPIGMDQEQDSGLQLVH...
arbuscular mycorrhizal association regulation of DNA-templated transcription response to symbiotic fungus cytoplasm; nucleus protein homodimerization activity Lotus japonicus Cytoplasm Nucleus Transcription Transcription regulation MINSMCGSSV MINSMCGSSVSLKSENSRNKPQPTSPNESVLQSKKNATQSSADLEQTSLNLTPPSLNLPALKFDLDGDVEVQSPDSS...
polysaccharide catabolic process
extracellular region
metal ion binding oxidoreductase activity starch binding
Pyricularia oryzae
Carbohydrate metabolism Copper Disulfide bond Glycoprotein Metal-binding Methylation Oxidoreductase Polysaccharide degradation Secreted Signal
MKWSVIQALA
MKWSVIQALALASGVQAHGYLTFPMSRTGLNAQAGPDTCPECTILEPVTAWPDLDSAQVGRSGPCGYNARVSVDYNQPGPRWGSAPVVTYKGGDVADVQWCVDNNGDHGGMFTYRICQDQALVDKLLTPGYLPSEAEKQAAENCFRAGTLPCTDVNGQSCGYSPDCSPGQACWRNDWFTCKGFQDTKCRGVDNAPLNSCYTSIAGGYTVSSRIKIPNYVSNHTLLSFKWNSFQTPQIYLTCADIKITAPDSQSPPTTTTTSTPASPPPTSCATPAASVAVTFRSKTTTSVGQTVKIAGSIAQLGGWDASKAPALSASQYT...
polysaccharide catabolic process extracellular region metal ion binding oxidoreductase activity starch binding Pyricularia oryzae Carbohydrate metabolism Copper Disulfide bond Glycoprotein Metal-binding Methylation Oxidoreductase Polysaccharide degradation Secreted Signal MKWSVIQALA MKWSVIQALALASGVQAHGYLTFPMSRTGLNAQA...
methylation
nucleus
histone H3K4 methyltransferase activity histone H3K4 monomethyltransferase activity
Caenorhabditis elegans
Alternative splicing Methyltransferase Nucleus Reference proteome S-adenosyl-L-methionine Transferase
MNIKHNYISY
MNIKHNYISYFQMNGIQIPGISNPEAIIPITGEKKSYKLVLDFNDGAISIIEARYLDSKLHREIQDLSDNDVTILGTEISDGAYDENLDIHCDKCNKFYRPYCRLHPLFKIPDRVLKRDESSNLSFSQQTLPILFRIEESKLPNAGLGVIAEVFIPVGMVFGPYKGRRCQKKTDFYKDGYAWLIKSGDKRFYIDGSDAERSNWLRYINSPRFEDEQNMLAFQTNGKIFYRVIKPIRINQELLVWYGSSYGNEFVESENGNKYKKPAKNPFICVGAQR
methylation nucleus histone H3K4 methyltransferase activity histone H3K4 monomethyltransferase activity Caenorhabditis elegansAlternative splicing Methyltransferase Nucleus Reference proteome S-adenosyl-L-methionine Transferase MNIKHNYISY MNIKHNYISYFQMNGIQIPGISNPEAIIPITGEKKSYKLVLDFNDGAISIIEARYLDSKLHREIQDLSDNDVTILGTEISD...
aromatic compound biosynthetic process coumarin biosynthetic process methylation response to jasmonic acid
cytoplasm
5-hydroxyfuranocoumarin 5-O-methyltransferase activity O-methyltransferase activity protein dimerization activity S-adenosylmethionine-dependent methyltransferase activity
Kitagawia praeruptora
3D-structure Cytoplasm Methyltransferase S-adenosyl-L-methionine Transferase
MAGMKTSPSQ
MAGMKTSPSQDEEACVLAIQLATSTVLPMILKSAIELDILNTISKAGPGNYLSPSDLASKLLMSNPHAPIMLERILRVLATYKVLGCKPSELSDGEVEWLYCWTPVCKFLSNNEDGASIAPLLLVHQDQVPMKSWYHLTDAILDGGTAFNKAYGMNIFDYASQDPQFNKVFNRSMAGHSTITMKKILETYNGFEGLKSIVDVGGGSGATLNMIISKYPTIKGINFDLPHVVGDSPIHPGVEHVGGDMFASVPKGDAIFLKWIFHSWSDEDCLRILKNCYEALADNKKVIVAEFIIPEVPGGSDDATKSVVHLDAVMLAYV...
aromatic compound biosynthetic process coumarin biosynthetic process methylation response to jasmonic acid cytoplasm 5-hydroxyfuranocoumarin 5-O-methyltransferase activity O-methyltransferase activity protein dimerization activity S-adenosylmethionine-dependent methyltransferase activity Kitagawia praeruptora 3D-struct...
cell cycle G2/M phase transition generative cell mitosis pollen sperm cell differentiation positive regulation of DNA-templated transcription
generative cell nucleus; nucleus
DNA-binding transcription factor activity sequence-specific DNA binding
Arabidopsis thaliana
Activator Cell cycle Developmental protein DNA-binding Nucleus Reference proteome Repeat Transcription Transcription regulation
MRKMEAKKEE
MRKMEAKKEEIKKGPWKAEEDEVLINHVKRYGPRDWSSIRSKGLLQRTGKSCRLRWVNKLRPNLKNGCKFSADEERTVIELQSEFGNKWARIATYLPGRTDNDVKNFWSSRQKRLARILHNSSDASSSSFNPKSSSSHRLKGKNVKPIRQSSQGFGLVEEEVTVSSSCSQMVPYSSDQVGDEVLRLPDLGVKLEHQPFAFGTDLVLAEYSDSQNDANQQAISPFSPESRELLARLDDPFYYDILGPADSSEPLFALPQPFFEPSPVPRRCRHVSKDEEADVFLDDFPADMFDQVDPIPSP
cell cycle G2/M phase transition generative cell mitosis pollen sperm cell differentiation positive regulation of DNA-templated transcription generative cell nucleus; nucleus DNA-binding transcription factor activity sequence-specific DNA binding Arabidopsis thaliana Activator Cell cycle Developmental protein DNA-bindi...
3,4-dihydroxybenzoate metabolic process cinnamic acid ester metabolic process ferulate metabolic process
cytoplasm
4-hydroxybenzoate 4-O-beta-D-glucosyltransferase activity cinnamate beta-D-glucosyltransferase activity flavone 7-O-beta-glucosyltransferase activity gallate 1-beta-glucosyltransferase activity isoflavone 7-O-glucosyltransferase activity sinapate 1-glucosyltransferase activity UDP-glucosyltransferase activity
Punica granatum
Cytoplasm Glycosyltransferase Reference proteome Transferase
MGSESLVHVF
MGSESLVHVFLVSFPGQGHVNPLLRLGKRLASKGLLVTFTTPESIGKQMRKASNIGEEPSPIGDGFIRFEFFEDGWDEDEPRRQDLDQYLPQLEKVGKEVIPRMIKKNEEQNRPVSCLINNPFIPWVSDVAESLGLPSAMLWVQSCACFAAYYHYYHGLVPFPSESAMEIDVQLPCMPLLKHDEVPSFLYPTTPYPFLRRAIMGQYKNLDKPFCVLMDTFQELEHEIIEYMSKICPIKTVGPLFKNPKAPNANVRGDFMKADDCISWLDSKPPASVVYVSFGSVVYLKQDQWDEIAFGLLNSGLNFLWVMKPPHKDSGYQ...
3,4-dihydroxybenzoate metabolic process cinnamic acid ester metabolic process ferulate metabolic process cytoplasm 4-hydroxybenzoate 4-O-beta-D-glucosyltransferase activity cinnamate beta-D-glucosyltransferase activity flavone 7-O-beta-glucosyltransferase activity gallate 1-beta-glucosyltransferase activity isoflavone ...
3,4-dihydroxybenzoate metabolic process cinnamic acid ester metabolic process ferulate metabolic process
cytoplasm
4-hydroxybenzoate 4-O-beta-D-glucosyltransferase activity cinnamate beta-D-glucosyltransferase activity flavone 7-O-beta-glucosyltransferase activity gallate 1-beta-glucosyltransferase activity isoflavone 7-O-glucosyltransferase activity sinapate 1-glucosyltransferase activity UDP-glucosyltransferase activity
Punica granatum
Cytoplasm Glycosyltransferase Reference proteome Transferase
MGSESSLVHV
MGSESSLVHVFLVSFPGQGHVNPLLRLGKRLASKGLLVTFTTPESIGKQMRKASNISDQPAPVGDGFIRFEFFEDGWDEDEPRRQDLDQYLPQLEKVGKVLIPQMIQKNAEQGRPVSCLINNPFIPWVSDVAETLGLPSAMLWVQSCACFLAYYHYYHGLVPFPSENAMEIDVQLPSMPLLKHDEVPSFLYPTTPYPFLRRAILGQYKNLEKPFCILMDTFQELEHEIIEYTSKICPIKTVGPLFKNPKAPNTTVKGDFMKADDCIGWLDSKPASSVVYVSFGSVVYLKQDQWDEIAYGLLNSGVNFLWVMKPPHKDSGY...
3,4-dihydroxybenzoate metabolic process cinnamic acid ester metabolic process ferulate metabolic process cytoplasm 4-hydroxybenzoate 4-O-beta-D-glucosyltransferase activity cinnamate beta-D-glucosyltransferase activity flavone 7-O-beta-glucosyltransferase activity gallate 1-beta-glucosyltransferase activity isoflavone ...
arachidonic acid secretion lipid catabolic process phospholipid metabolic process
extracellular region
calcium ion binding ion channel regulator activity phospholipase A2 activity toxin activity
Crotalus tzabcan
Blood coagulation cascade inhibiting toxin Calcium Direct protein sequencing Disulfide bond Hemostasis impairing toxin Hydrolase Ion channel impairing toxin Lipid degradation Lipid metabolism Metal-binding Neurotoxin Presynaptic neurotoxin Secreted Signal Toxin
MRALWIVAVL
MRALWIVAVLLVGVEGHLLQFNKMIKFETRKNAIPFYAFYGCYCGWGGRGRPKDATDRCCFVHDCCYGKLAKCNTKWDIYPYSLKSGYITCGKGTWCEEQICECDRVAAECLRRSLSTYKYGYMFYPDSRCRGPSETC
arachidonic acid secretion lipid catabolic process phospholipid metabolic process extracellular region calcium ion binding ion channel regulator activity phospholipase A2 activity toxin activity Crotalus tzabcan Blood coagulation cascade inhibiting toxin Calcium Direct protein sequencing Disulfide bond Hemostasis impa...
auditory behavior catecholamine catabolic process detection of mechanical stimulus involved in sensory perception developmental process dopamine metabolic process endocytosis hair cell differentiation inner ear receptor cell stereocilium organization methylation neuromast development sensory perception of sound
basolateral plasma membrane; endoplasmic reticulum; Golgi apparatus
catechol O-methyltransferase activity L-dopa O-methyltransferase activity orcinol O-methyltransferase activity
Danio rerio
Catecholamine metabolism Cell membrane Deafness Endoplasmic reticulum Golgi apparatus Hearing Membrane Methyltransferase Neurotransmitter degradation Reference proteome S-adenosyl-L-methionine Transferase
MVSPAIALAF
MVSPAIALAFLPLLLTLIIRYRYYFVLLYRAVLTRWVRDCLSGISREERAFQYILTHATPGDSQSILDTFDTWCSKVEFISNIGPKKGKILDRLLQENCPITVLELGTHCGYSTVRMARSLPIGARIYSVEMDQRNAQVAEKIIRLAGFDDDMVELIQRPSDEVIPRLREDLGVERLDLVLMDHWKRCYLPDLHLLEDSGLIGQGSIILADNVIFPGAPNFLRYARRCGLYEVRVHRATLEYMRGIPDGMAELTYIGIK
auditory behavior catecholamine catabolic process detection of mechanical stimulus involved in sensory perception developmental process dopamine metabolic process endocytosis hair cell differentiation inner ear receptor cell stereocilium organization methylation neuromast development sensory perception of sound basolat...
cell adhesion establishment of left/right asymmetry proteolysis
cytoplasm; membrane
metal ion binding metalloendopeptidase activity peptidase activity
Homo sapiens
Alternative splicing Disease variant Glycoprotein Heterotaxy Hydrolase Membrane Metal-binding Metalloprotease Protease Reference proteome Signal Transmembrane Transmembrane helix Zinc
MLLLLLLLLL
MLLLLLLLLLLPPLVLRVAASRCLHDETQKSVSLLRPPFSQLPSKSRSSSLTLPSSRDPQPLRIQSCYLGDHISDGAWDPEGEGMRGGSRALAAVREATQRIQAVLAVQGPLLLSRDPAQYCHAVWGDPDSPNYHRCSLLNPGYKGESCLGAKIPDTHLRGYALWPEQGPPQLVQPDGPGVQNTDFLLYVRVAHTSKCHQETVSLCCPGWSTAAQSQLTAALTSWAQRRGFVMLPRLCLKLLGSSNLPTLASQSIRITGPSVIAYAACCQLDSEDRPLAGTIVYCAQHLTSPSLSHSDIVMATLHELLHALGFSGQLFKK...
cell adhesion establishment of left/right asymmetry proteolysis cytoplasm; membrane metal ion binding metalloendopeptidase activity peptidase activity Homo sapiens Alternative splicing Disease variant Glycoprotein Heterotaxy Hydrolase Membrane Metal-binding Metalloprotease Protease Reference proteome Signal Transmembra...
central nervous system myelination positive regulation of myelination positive regulation of oligodendrocyte differentiation regulation of transcription by RNA polymerase II
nucleus
DNA-binding transcription factor activity, RNA polymerase II-specific metal ion binding RNA polymerase II transcription regulatory region sequence-specific DNA binding
Danio rerio
Alternative splicing Coiled coil Metal-binding Neurogenesis Nucleus Reference proteome Repeat Transcription Transcription regulation Zinc Zinc-finger
MSRKRNHCYM
MSRKRNHCYMETGASSESQGAFVDSAGPFSRDEEDFSELEPDEQLVCSVTEITEHLGRNITVVLESALSEIRKLVGVRIRVLKMELREKSDEIELLKAKLESAEKDGRVSNFSSLDFRKSEHQKYGAEPKKAKTGTPVVKKENINAICDYLMKDKNQRGAAEVESDHSNQAFGSERDVRTEAQPHGSLSLWPDSGPADTDAETDIFSMLPSASKRMYDYEWMTGVELNSAEFKGDSETKCEDVPPMDEEDENEDSEEGRGSLRSVSDHFPLDTQGSPGEDRSSPAEDSMDRMEPGQQFTSHTFICPFCGTLCPDSSFLEE...
central nervous system myelination positive regulation of myelination positive regulation of oligodendrocyte differentiation regulation of transcription by RNA polymerase II nucleus DNA-binding transcription factor activity, RNA polymerase II-specific metal ion binding RNA polymerase II transcription regulatory region ...
cell adhesion determination of heart left/right asymmetry establishment of left/right asymmetry proteolysis
cytoplasm; membrane
metal ion binding metalloendopeptidase activity peptidase activity
Danio rerio
Developmental protein Hydrolase Membrane Metal-binding Metalloprotease Protease Reference proteome Signal Transmembrane Transmembrane helix Zinc
MSFLLCIGIL
MSFLLCIGILLLPWFPCVCGKCIFDQIQRSVNVVSPPTAQYASAYRFKTQRSKRHIMPMDNLQPIRIKIWIPSESPALSDWEREKLMSAVGEAVSEVSSLLSVKRVKDRLLLNRDVNKYCKFIWRNSSTLNHMKCGRAHENYRFESCLGVIIPDEHLDGCSVYPNPEHPVPTVLRPRGPGVPDADFLLYVFTHNTEKCRAESSVLAYTAHCQTGSDGRPLAGTMVICRETLKKERYTYQHFVKVTTVIHELFHVLGFSKELLSNWKDFGVDCWSHGQVTSTDQTGQVRLYSPTVIRAMQKHFNSTHTDLGAPLENKDAAL...
cell adhesion determination of heart left/right asymmetry establishment of left/right asymmetry proteolysis cytoplasm; membrane metal ion binding metalloendopeptidase activity peptidase activity Danio rerio Developmental protein Hydrolase Membrane Metal-binding Metalloprotease Protease Reference proteome Signal Transm...
activation of innate immune response apoptotic chromosome condensation apoptotic DNA fragmentation apoptotic nuclear changes apoptotic process hepatocyte apoptotic process intrinsic apoptotic signaling pathway by p53 class mediator lens fiber cell differentiation positive regulation of apoptotic process positive regula...
cytoplasm; nucleus
cysteine-type endopeptidase activity cysteine-type endopeptidase activity involved in apoptotic process cysteine-type peptidase activity
Gallus gallus
Apoptosis Autocatalytic cleavage Cytoplasm Hydrolase Nucleus Protease Reference proteome Thiol protease Zymogen
MSGAERRPAA
MSGAERRPAAGRVQLDSKPTPTTTADGNQNITEVDAFDKRQTFDPAVQYKMNHQRRGVALIFNHEHFFWHLRLPDRRGTLADRNNLKRSLTDLGFEVRIFDDLKAEDVLKKVFEASRDDYSNADCFVCVFLSHGENDHVYAYDAQIKIETITNMFRGDKCQSLVGKPKIFIIQACRGDKHDDPVLVQDSVDSKDETTVNQTEVDAAGVYTLPAGADFIMCYSVAQGYFSHRETVNGSWYIQDLCEALGKHGSSLEFTELLTVVNRKVSHRKVDICRDINAIGKKQIPCFASMLTKKLYFHPKSK
activation of innate immune response apoptotic chromosome condensation apoptotic DNA fragmentation apoptotic nuclear changes apoptotic process hepatocyte apoptotic process intrinsic apoptotic signaling pathway by p53 class mediator lens fiber cell differentiation positive regulation of apoptotic process positive regula...
blood vessel maturation canonical Wnt signaling pathway extracellular matrix organization negative regulation of metalloendopeptidase activity regulation of angiogenesis regulation of establishment of blood-brain barrier sprouting angiogenesis
extracellular space; plasma membrane; side of membrane; Wnt signalosome
coreceptor activity endopeptidase inhibitor activity metalloendopeptidase inhibitor activity serine-type endopeptidase inhibitor activity
Gallus gallus
Cell membrane Disulfide bond Glycoprotein GPI-anchor Lipoprotein Membrane Protease inhibitor Reference proteome Repeat Serine protease inhibitor Signal Wnt signaling pathway
MAAAVAAWPW
MAAAVAAWPWALFCLAAVPPLLSPGAAGLSCCYHAKDNLMCRDVCEQILSSKSDSRLKHLLQRAPEYCPESMGEVWGCINSSLPGVLKKSDGWVGLGCCELAIAVECRQACKQASSKNDILKVCRKEYENALFSCINRNEMGSICCSYAGHHTNCREYCQAIFRTDSSPGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDYACQTACKRILMSMKTELEIVDGLIEGCKTMPLPQDPLWQCFLESSRSVHPGVTVHPPPSTGLDGAKLHCCSKANSSTCRELCTKLYSTSWGSSQSWQEFDRFC...
blood vessel maturation canonical Wnt signaling pathway extracellular matrix organization negative regulation of metalloendopeptidase activity regulation of angiogenesis regulation of establishment of blood-brain barrier sprouting angiogenesis extracellular space; plasma membrane; side of membrane; Wnt signalosome core...
intracellular calcium ion homeostasis osmosensory signaling pathway
adherens junction; apical plasma membrane; plasma membrane
ATP binding calcium channel activity calmodulin binding lipid binding metal ion binding monoatomic cation channel activity
Gallus gallus
3D-structure ANK repeat ATP-binding Calcium Calcium channel Calcium transport Calmodulin-binding Cell junction Cell membrane Ion channel Ion transport Lipid-binding Membrane Metal-binding Nucleotide-binding Reference proteome Repeat Transmembrane Transmembrane helix Transport
MADPEDPRDA
MADPEDPRDAGDVLGDDSFPLSSLANLFEVEDTPSPAEPSRGPPGAVDGKQNLRMKFHGAFRKGPPKPMELLESTIYESSVVPAPKKAPMDSLFDYGTYRQHPSENKRWRRRVVEKPVAGTKGPAPNPPPILKVFNRPILFDIVSRGSPDGLEGLLSFLLTHKKRLTDEEFREPSTGKTCLPKALLNLSAGRNDTIPILLDIAEKTGNMREFINSPFRDVYYRGQTALHIAIERRCKHYVELLVEKGADVHAQARGRFFQPKDEGGYFYFGELPLSLAACTNQPHIVHYLTENGHKQADLRRQDSRGNTVLHALVAIADN...
intracellular calcium ion homeostasis osmosensory signaling pathway adherens junction; apical plasma membrane; plasma membrane ATP binding calcium channel activity calmodulin binding lipid binding metal ion binding monoatomic cation channel activity Gallus gallus 3D-structure ANK repeat ATP-binding Calcium Calcium chan...
cell surface receptor signaling pathway detection of symbiotic fungus innate immune response phosphorylation positive regulation of plant-type hypersensitive response
external side of plasma membrane; plasma membrane
ATP binding calcium ion binding protein serine/threonine kinase activity
Zea mays
Alternative splicing ATP-binding Calcium Cell membrane Disulfide bond EGF-like domain Glycoprotein Kinase Membrane Nucleotide-binding Receptor Reference proteome Repeat Serine/threonine-protein kinase Signal Transferase Transmembrane Transmembrane helix
MPSRSPACRP
MPSRSPACRPRGRNRRSAADAVARPLALALILVSTLPRAAHSQDLALPPVQPRGVRRTMTCDNIPEPFGTRSRGASRLPGFEVTCGPNREAMLSIGGDAYMIDFVSVSGSYVVVFAEPITQVCYDGKGKPTPDTGTGAKSSEGTTTTFTWSLEGTPFTFSKSNKLVNFGCNRTLMANFFIVPGDSSPLYTSCTTTCNTLQISGSCLGEACCEAPMDQVNGAKAFSLSFERTTANGTGEEDGTCSAAFFLDKDETVFTFSGDEVRPLKTALLPPGERRMVLDWAIGSTSCEQTQSYTFEKLCKYGTCVDAPTGAGYLCKCP...
cell surface receptor signaling pathway detection of symbiotic fungus innate immune response phosphorylation positive regulation of plant-type hypersensitive response external side of plasma membrane; plasma membrane ATP binding calcium ion binding protein serine/threonine kinase activity Zea mays Alternative splicing ...
defense response to fungus diterpenoid biosynthetic process sesquiterpene biosynthetic process terpene biosynthetic process
cytoplasm
magnesium ion binding terpene synthase activity
Zea mays
Cytoplasm Lyase Magnesium Manganese Metal-binding Plant defense Reference proteome
MAPSNIVVQS
MAPSNIVVQSSSTPPVAGGDEEFAPSVWGDFFVTYATPVSQASEQRMSERAELLKAQVRQAFDAASMDVAGLITYVDTLERLGLDNHFRDLIGAALERIGAEELPEHGGGLHIVALRFRLLRQHGIWVSTDVFDAFREDAGGFCSSLCSDDPRGLLSLYNAAHMAVPGEVVLDDAIAFARGRLLDIISKGEVRSPVSEQITRALDIPLPRFTRRLETMHYIAEYEHEEAHDGLLLELARLNFVLVRALHLRELKDLSLWWRELYNTVKLPYARDRMVEIYFWTCGMLHEEEYSLARMFFAKTFGMVSLMDDTFDVHATLD...
defense response to fungus diterpenoid biosynthetic process sesquiterpene biosynthetic process terpene biosynthetic process cytoplasm magnesium ion binding terpene synthase activity Zea mays Cytoplasm Lyase Magnesium Manganese Metal-binding Plant defense Reference proteome MAPSNIVVQS MAPSNIVVQSSSTPPVAGGDEEFAPSVWGDFFVTY...
defense response response to herbivore terpenoid biosynthetic process
membrane
4,8,12-trimethyltrideca-1,3,7,11-tetraene synthase activity DMNT synthase activity heme binding iron ion binding terpene synthase activity
Zea mays
Heme Iron Membrane Metal-binding Monooxygenase Oxidoreductase Plant defense Reference proteome Transmembrane Transmembrane helix
MELASTMSVA
MELASTMSVAMALAAAIFVVLCSVVASARGRREKALKLPPGPRGWPVLGSLGALAGALPPHRALAALAARHGPLMHLRLGSYHTVVASSADAARLVLRTHDSALADRPDTAAGEITSYGYLGIVHTPRGAYWRMARRLCATELFSARRVESFQDVRAQEMRALARGLFGCAAGRRAVAVREHVAGATMRNILRMAVGEKWSGCYGSPEGEAFRRSLDEAFAATGAVSNVGEWVPWLGWLDVQGFKRKMKRLHDLHDHFYEKILVDHEERRRLAQASGGEFVATDLVDVLLQLSEESTKLESESEARLPRDGVKALIQDII...
defense response response to herbivore terpenoid biosynthetic process membrane 4,8,12-trimethyltrideca-1,3,7,11-tetraene synthase activity DMNT synthase activity heme binding iron ion binding terpene synthase activity Zea mays Heme Iron Membrane Metal-binding Monooxygenase Oxidoreductase Plant defense Reference proteom...
chloroplast mRNA processing chloroplast organization mRNA processing positive regulation of translation
chloroplast; chloroplast nucleoid; chloroplast stroma; cytoplasm; thylakoid membrane
mRNA binding single-stranded RNA binding
Zea mays
Chloroplast mRNA processing Plastid Reference proteome Repeat RNA-binding Transit peptide Translation regulation
MPASLLPPTF
MPASLLPPTFLPHHLRRLAPAGCTTSSVTSSSVSIPASRYDFEPLLAYLSSPSVSASLTSPSPPASVPAPEHRLAASYSAVPSHEWHALLRDLAASDASLPLAFALLPFLHRHRLCFPLDLLLSSLLHSLSVSGRLLPHSLLLSFPPSLSDPPSPLLLNSLLAASAAASRPAVALRLLSLLREHDFLPDLASYSHLLASLLNTRDPPDAALLERLLGDLRESRLEPDAPLFSDLISAFARAALPDAALELLASAQAIGLTPRSNAVTALISALGTAGRVAEAEALFLEFFLAGEIKPRTRAYNALLKGYVRIASLKNAEQ...
chloroplast mRNA processing chloroplast organization mRNA processing positive regulation of translation chloroplast; chloroplast nucleoid; chloroplast stroma; cytoplasm; thylakoid membrane mRNA binding single-stranded RNA binding Zea mays Chloroplast mRNA processing Plastid Reference proteome Repeat RNA-binding Transit...
defense response diterpene phytoalexin biosynthetic process diterpenoid biosynthetic process gibberellin biosynthetic process
chloroplast
ent-copalyl diphosphate synthase activity isomerase activity magnesium ion binding terpene synthase activity
Zea mays
Chloroplast Isomerase Magnesium Metal-binding Plant defense Plastid Reference proteome Transit peptide
MVLSSSCTTV
MVLSSSCTTVPHLSSLAVVQLGPWSSRIKKKTDAVAVPAAAGRWRARARAQDTSESAAVAKGSSLTPIVRTDAESRRTRWPTDDDDAEPLVDEIRAMLTSMSDGDISVSAYDTAWVGLVPRLDGGEGPQFPAAVRWIRNNQLPDGSWGDAALFSAYDRLINTLACVVTLTRWSLEPEMRGRGLSFLGRNMWKLATEDEESMPIGFELAFPSLIELAKSLGVHDFPYDHQALQAIYSSREIKVKRIPKEVMHTVPTSILHSLEGMPGLDWARLLKLQSSDGSFLFSPAATAYALMNTGDDRCFSYIDRTVKKFNGGVPNVY...
defense response diterpene phytoalexin biosynthetic process diterpenoid biosynthetic process gibberellin biosynthetic process chloroplast ent-copalyl diphosphate synthase activity isomerase activity magnesium ion binding terpene synthase activity Zea mays Chloroplast Isomerase Magnesium Metal-binding Plant defense Plas...
embryo development ending in seed dormancy flower development leaf vascular tissue pattern formation maintenance of meristem identity photomorphogenesis proteolysis regulation of floral meristem growth regulation of inflorescence meristem growth regulation of root meristem growth regulation of seed maturation
plasma membrane
carboxypeptidase activity metal ion binding metallocarboxypeptidase activity
Zea mays
Cell membrane Developmental protein Glycoprotein Growth regulation Hydrolase Membrane Metal-binding Metalloprotease Protease Reference proteome Signal-anchor Transmembrane Transmembrane helix Zinc
MPHSVLARLP
MPHSVLARLPPGSVRLVAAFGLLLLVSLLVLHRRPGRPHVAAAAASDRLTDPSRSRLFLSQSPGANASIAADLRALTAGPHLAGTPASAGAAAHVLARLRAAGLQTLTREYEPLLSYPGHASLALLRPDGSLLARLSLEEPADEGRRVVPPYHAYAPSGGAVAEAVFVNLGREEDYVVLERLGVGVRGRVAVARRGGGYRGGVVARAADKGAVAVLIAGNADGGVERGVVLLGGPGDPLTPGWAATSGAERLKFDDKAVKQRFPSIPSMPVSAKTAAAIIRSLGGPAIPAEWKDGLGVDTGGLGPGPTLVNFTYQEDRKF...
embryo development ending in seed dormancy flower development leaf vascular tissue pattern formation maintenance of meristem identity photomorphogenesis proteolysis regulation of floral meristem growth regulation of inflorescence meristem growth regulation of root meristem growth regulation of seed maturation plasma me...
chloroplast organization Group II intron splicing ribosome biogenesis
chloroplast stroma; cytoplasm
ATP binding ATP hydrolysis activity RNA binding RNA helicase activity zinc ion binding
Zea mays
ATP-binding Chloroplast Helicase Hydrolase Metal-binding Nucleotide-binding Plastid Reference proteome Ribosome biogenesis RNA-binding Transit peptide Zinc Zinc-finger
MASLTLPALA
MASLTLPALALALSNPGAVRLRAAAFRCWALRRRGWAAAGALASPNSVLSEHAFKRLQLGSDDEDGEGPYGSDADEGFEAGEGDNEELAIARLGLPDELVATLEKRGITHLFPIQRAVLIPALEGRDLIARAKTGTGKTLAFGIPMIKQLIEQDDGRITRRGRTPRVLVLAPTRELAKQVEKEIKESAPKLGTVCVYGGVSYNVQQNALSRGVDVVVGTPGRIIDLINGGSLQLGEVQYLVLDEADQMLAVGFEEDVETILQQLPAGRQSMLFSATMPSWVKKLSRRYLNNPLTIDLVGDQDEKLAEGIKLYAIPLTTTS...
chloroplast organization Group II intron splicing ribosome biogenesis chloroplast stroma; cytoplasm ATP binding ATP hydrolysis activity RNA binding RNA helicase activity zinc ion binding Zea mays ATP-binding Chloroplast Helicase Hydrolase Metal-binding Nucleotide-binding Plastid Reference proteome Ribosome biogenesis R...
diterpenoid biosynthetic process response to wounding terpenoid biosynthetic process
chloroplast
(4S)-limonene synthase activity gamma-terpinene synthase activity magnesium ion binding myrcene synthase activity terpene synthase activity
Zea mays
Alternative splicing Chloroplast Cobalt Lyase Magnesium Manganese Metal-binding Plastid Reference proteome Transit peptide
MAGITGVMNM
MAGITGVMNMKLAARPSSGRHSRGCRPAVVPSAGKQMLLVRRHPPGSASWPTRATGGGGGGVPAGATAADSSGQAKEEEEEDRASRNTSSFEPSIWGDFFLTYSSPLATSSAQKARMVHRAEQLKKQVAKLIAASGACSLYHRIHLVDALERLCLDYLFEDEINDMVTQIHNVDVSGCDLQTVAMWFYLLRNHGYRVSSDVVFAKFRDEQGGFAANNPRDLLNLYNAACLRTHGETILDEAASFTSKCLKSLAPYTYMEASLASEIKRALEIPLPRSVRIYGAKSRIAEYGNQTEANELVLELAKLNYNLVQLQHQEELK...
diterpenoid biosynthetic process response to wounding terpenoid biosynthetic process chloroplast (4S)-limonene synthase activity gamma-terpinene synthase activity magnesium ion binding myrcene synthase activity terpene synthase activity Zea mays Alternative splicing Chloroplast Cobalt Lyase Magnesium Manganese Metal-bi...
defense response to virus translational initiation
cytoplasm; nucleus
RNA binding translation initiation factor activity
Solanum pimpinellifolium
Cytoplasm Disulfide bond Host-virus interaction Initiation factor Nucleus Plant defense Protein biosynthesis RNA-binding Translation regulation
MAAAEMERTM
MAAAEMERTMSFDAAEKLKAADGGGGEVDDELEEGEIVEESNDTASYLGKEITVKHPLEHSWTFWFDNPTTKSRQTAWGSSLRNVYTFSTVEDFWGAYNNIHHPSKLIMGADFHCFKHKIEPKWEDPVCANGGTWKMSFSKGKSDTSWLYTLLAMIGHQFDHGDEICGAVVSVRAKGEKIALWTKNAANETAQVSIGKQWKQFLDYSDSVGFIFHDDAKRLDRNAKNRYTV
defense response to virus translational initiation cytoplasm; nucleus RNA binding translation initiation factor activity Solanum pimpinellifolium Cytoplasm Disulfide bond Host-virus interaction Initiation factor Nucleus Plant defense Protein biosynthesis RNA-binding Translation regulation MAAAEMERTM MAAAEMERTMSFDAAEKL...
carbohydrate transport cellular response to heat cellular response to neutral pH filamentous growth filamentous growth of a population of unicellular organisms in response to heat filamentous growth of a population of unicellular organisms in response to neutral pH glucose transmembrane transport negative regulation of...
extracellular vesicle; membrane; plasma membrane
carbohydrate:proton symporter activity glucose transmembrane transporter activity
Candida albicans
Cell membrane Glycoprotein Membrane Reference proteome Transmembrane Transmembrane helix Transport
MSSKIERIFS
MSSKIERIFSGPALKINTYLDKLPKIYNVFFIASISTIAGMMFGFDISSMSAFIGAEHYMRYFNSPGSDIQGFITSSMALGSFFGSIASSFVSEPFGRRLSLLTCAFFWMVGAAIQSSVQNRAQLIIGRIISGIGVGFGSAVAPVYGAELAPRKIRGLIGGMFQFFVTLGIMIMFYLSFGLGHINGVASFRIAWGLQIVPGLCLFLGCFFIPESPRWLAKQGQWEAAEEIVAKIQAHGDRENPDVLIEISEIKDQLLLEESSKQIGYATLFTKKYIQRTFTAIFAQIWQQLTGMNVMMYYIVYIFQMAGYSGNSNLVASS...
carbohydrate transport cellular response to heat cellular response to neutral pH filamentous growth filamentous growth of a population of unicellular organisms in response to heat filamentous growth of a population of unicellular organisms in response to neutral pH glucose transmembrane transport negative regulation of...
ascospore-type prospore membrane formation autophagosome assembly autophagy cellular response to osmotic stress cellular response to starvation endocytosis filamentous growth filamentous growth of a population of unicellular organisms in response to biotic stimulus filamentous growth of a population of unicellular orga...
cytoplasm; endosome; endosome membrane; fungal-type vacuole membrane; Golgi apparatus; membrane; nucleus-vacuole junction; peroxisome; phagophore assembly site; phosphatidylinositol 3-kinase complex, class III, type I; phosphatidylinositol 3-kinase complex, class III, type II
1-phosphatidylinositol-3-kinase activity ATP binding protein kinase activity
Candida albicans
ATP-binding Endosome Golgi apparatus Kinase Membrane Nucleotide-binding Reference proteome Transferase
MATLSQPQSA
MATLSQPQSALPKTKIATTFGLSKDLKSPISVKVCYLECTRNNVSLVPLSTKFEDPTVFKKLSQIYKNSDLFVEIRVYDGKNNNLISTPVRTSYKAFNNKGRTWNQQLKLNIDYNQISIDAYLKFSICEIIDTKPSVFGVSYLSLFSHDSSTLRSGSHKIPVFMEDDPQYSKNIQYGTLIGLTDLEKRLIDYENGKYPRLNWLDKMVLPKVDATFLKTNNKDHDYYLYIELPQFEFPIVYSDIIYQIPTIEPITETTSKIPPDDTLNSNIIINSIDIPMATSHDPSIMKVYDPDFHITANNHLNPNATTFDPVELKYRKL...
ascospore-type prospore membrane formation autophagosome assembly autophagy cellular response to osmotic stress cellular response to starvation endocytosis filamentous growth filamentous growth of a population of unicellular organisms in response to biotic stimulus filamentous growth of a population of unicellular orga...
DNA-templated transcription filamentous growth filamentous growth of a population of unicellular organisms in response to biotic stimulus positive regulation of filamentous growth of a population of unicellular organisms in response to biotic stimulus regulation of single-species biofilm formation on inanimate substrat...
chromatin; nucleus
DNA-binding transcription activator activity DNA-binding transcription factor activity, RNA polymerase II-specific sequence-specific DNA binding zinc ion binding
Candida albicans
DNA-binding Metal-binding Nucleus Reference proteome Transcription Transcription regulation Zinc
MTPSSTKKIK
MTPSSTKKIKQRRSTSCTVCRTIKRKCDGNTPCSNCLKRNQECIYPDVDKRKKRYSIEYITNLENTNQQLHDQLQSLIDLKDNPYQLHLKITEILESSSSFLDNSETKSDSSLGSPELSKSEASLANSFTLGGELVVSSREQGANFHVHLNQQQQQQQPSPQSLSQSSASEVSTRSSPASPNSTISLAPQILRIPSRPFQQQTRQNLLRQSDLPLHYPISGKTSGPNASNITGSIASTISGSRKSSISVDISPPPSLPVFPTSGPTLPTLLPEPLPRNDFDFAPKFFPAPGGKSNMAFGATTVYDADESMVMNVNQIEER...
DNA-templated transcription filamentous growth filamentous growth of a population of unicellular organisms in response to biotic stimulus positive regulation of filamentous growth of a population of unicellular organisms in response to biotic stimulus regulation of single-species biofilm formation on inanimate substrat...
mitochondrial electron transport, ubiquinol to cytochrome c
mitochondrial respiratory chain complex III; plasma membrane
electron transfer activity heme binding metal ion binding ubiquinol-cytochrome-c reductase activity
Candida albicans
3D-structure Electron transport Heme Iron Membrane Metal-binding Mitochondrion Mitochondrion inner membrane Reference proteome Respiratory chain Translocase Transmembrane Transmembrane helix Transport
MFRTAYKTMN
MFRTAYKTMNQSMVQKFIAGGVGVTGLTASYLLYQDSMTADAMTAAEHGLHPPAYNWPHNGMFETFDHASIRRGFQVYREVCAACHSLDRIAWRNLVGVSHTTSEAKAMAEELEYDDEPDDEGKPRKRPGKLADYIPGPYENEQAARAANQGAYPPDLSLIVKARHGGSDYIFSLLTGYPDEPPAGVVLPEGSNYNPYFPGGAIAMGRVLFDDLVEYEDGTPATTSQMAKDVSTFLNWASEPEHDDRKKWGLKALVVLSSLYLLSIWVKRFKWTPIKNRKFRFDPPKK
mitochondrial electron transport, ubiquinol to cytochrome c mitochondrial respiratory chain complex III; plasma membrane electron transfer activity heme binding metal ion binding ubiquinol-cytochrome-c reductase activity Candida albicans 3D-structure Electron transport Heme Iron Membrane Metal-binding Mitochondrion Mi...
cell wall organization metabolic process
cell surface; extracellular region; fungal-type cell wall; hyphal cell wall
hydrolase activity, acting on glycosyl bonds
Candida albicans
Cell wall biogenesis/degradation Glycosidase Hydrolase Reference proteome Secreted Signal Virulence
MKFSSTTLLA
MKFSSTTLLAGLSSLTATVSAGCSFEGGNYYCSETKKVIYKGIGFSGTYMDVTNMDESTGKCTQQSYSFSGNLSPLDEELSVHFRGPLTLLQFGVYYPSSSGNSKRQIDDQDCNVKHVHHKHKRATEVVQVTQTVFVDGNGNTVTSQALQTSTVESSPAVSSAAADDNANSGSGSGSSAGSGSGYGSVSALDGEGKAYRSDISTKSAPTSTSAQPSSSETASVDGAWTRDSYYTPGSTDNCVFLNYHGGSGSGVWSAKFGNSLSYANADNSGGSSTPVPLEETTIKSGEEYIIFSGSKCGSSSDCGYYRKGTVAYHGFKG...
cell wall organization metabolic process cell surface; extracellular region; fungal-type cell wall; hyphal cell wall hydrolase activity, acting on glycosyl bonds Candida albicans Cell wall biogenesis/degradation Glycosidase Hydrolase Reference proteome Secreted Signal Virulence MKFSSTTLLA MKFSSTTLLAGLSSLTATVSAGCSFEGGN...
mitochondrial electron transport, ubiquinol to cytochrome c
mitochondrial respiratory chain complex III; plasma membrane
2 iron, 2 sulfur cluster binding metal ion binding oxidoreductase activity ubiquinol-cytochrome-c reductase activity
Candida albicans
2Fe-2S 3D-structure Disulfide bond Electron transport Iron Iron-sulfur Membrane Metal-binding Mitochondrion Mitochondrion inner membrane Reference proteome Respiratory chain Transit peptide Translocase Transmembrane Transmembrane helix Transport
MSSLAFRTLR
MSSLAFRTLRNGLGLKSSVRALSTTTTTLSNYQQPDYSSYLNNKSGQGSRNFTYFMVGSMGLLSAAGAKSTVEAFLSSFAASADVLAMAKVEVKLGAIPEGKNVIIKWQGKPVFIRHRTADEIEEANQVDIKTLRDPQNDADRVKKPEWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPEYDFTDDETLLVG
mitochondrial electron transport, ubiquinol to cytochrome c mitochondrial respiratory chain complex III; plasma membrane 2 iron, 2 sulfur cluster binding metal ion binding oxidoreductase activity ubiquinol-cytochrome-c reductase activity Candida albicans 2Fe-2S 3D-structure Disulfide bond Electron transport Iron Iron-...
cellular response to oxidative stress cellular response to steroid hormone stimulus DNA-templated transcription filamentous growth filamentous growth of a population of unicellular organisms in response to biotic stimulus positive regulation of filamentous growth of a population of unicellular organisms in response to ...
nucleus; transcription regulator complex
DNA binding DNA-binding transcription activator activity DNA-binding transcription factor activity, RNA polymerase II-specific transcription coactivator activity zinc ion binding
Candida albicans
DNA-binding Metal-binding Nucleus Reference proteome Transcription Transcription regulation
MDTSSSSGTH
MDTSSSSGTHPSTFNNLTKQQELTGNDPNDTNRKRIRVACDSCRRKKIKCNGSYPCGNCIQAKNTSNCHFTERPVRKKLKPTKQDNKSTANSNGVSKRKYNDTFSGNSINIKTEKQENTTFGINDNKSSDLESRLSRIENSMSRMMHTLENFSQNFMTQAIRNNHSNSSMFNNNSLSPTPSEDFNKSAFDSEEQQTSHSYKNLKDRVKDANELLKLRNWDEFVGTHSITCIFSRESLDWMEKTLGSYGEEYLTPIRNLPLVFHSELKPYIMKWIDPPVVDKLQRKKLLESPFPTDSKLISKLIDLYYEETSMINILVDES...
cellular response to oxidative stress cellular response to steroid hormone stimulus DNA-templated transcription filamentous growth filamentous growth of a population of unicellular organisms in response to biotic stimulus positive regulation of filamentous growth of a population of unicellular organisms in response to ...
cellular response to metal ion cellular response to starvation filamentous growth filamentous growth of a population of unicellular organisms filamentous growth of a population of unicellular organisms in response to biotic stimulus filamentous growth of a population of unicellular organisms in response to starvation i...
membrane
spermidine transmembrane transporter activity
Candida albicans
Glycoprotein Membrane Reference proteome Transmembrane Transmembrane helix Transport
MAQLSSQGNN
MAQLSSQGNNAIIYLSYAFMLATGLFLAWKFSSNKDFLSSNGTQRGIPLALNFVASAMGVGIITTYAQIANIAGLHGLLVYTICGAIPIVGFAVVGPVIRRKCPDGFILTEWVRHRFGMVTALYLSAFTCLTMFLFMVGELSAIRSAIETLTGLNALGAVIVECVVTTIYTFFGGFRVSFITDNFQGVCVLLLLIICAAGMGSYIEIDTSKIGPSGLLKANKLGWQLVYILFVAIVTNDCFMSGFWLRTFASKTDKDLWIGTSIAAFVTFAICTLIGTTGFLAVWSGDLIVGDENGYDAFFILLSKMPRWLVAFVLIFCI...
cellular response to metal ion cellular response to starvation filamentous growth filamentous growth of a population of unicellular organisms filamentous growth of a population of unicellular organisms in response to biotic stimulus filamentous growth of a population of unicellular organisms in response to starvation i...
steroid metabolic process
cell surface; fungal-type vacuole; hyphal cell wall
estrogen binding FMN binding hormone binding NADPH dehydrogenase activity steroid binding
Candida albicans
Flavoprotein FMN NADP Oxidoreductase Reference proteome
MTIESTNSFV
MTIESTNSFVVPSDTELIDVTPLGSTKLFQPIKVGNNVLPQRIAYVPTTRFRASKDHIPSDLQLNYYNARSQYPGTLIITEATFASERGGIDLHVPGIYNDAQAKSWKKINEAIHGNGSFSSVQLWYLGRVANAKDLKDSGLPLIAPSAVYWDENSEKLAKEAGNELRALTEEEIDHIVEVEYPNAAKHALEAGFDYVEIHGAHGYLLDQFLNLASNKRTDKYGCGSIENRARLLLRVVDKLIEVVGANRLALRLSPWASFQGMEIEGEEIHSYILQQLQQRADNGQQLAYISLVEPRVTGIYDVSLKDQQGRSNEFAYK...
steroid metabolic process cell surface; fungal-type vacuole; hyphal cell wall estrogen binding FMN binding hormone binding NADPH dehydrogenase activity steroid binding Candida albicans Flavoprotein FMN NADP Oxidoreductase Reference proteome MTIESTNSFV MTIESTNSFVVPSDTELIDVTPLGSTKLFQPIKVGNNVLPQRIAYVPTTRFRASKDHIPSDLQLNYY...
hyphal growth
cell surface; cell wall-bounded periplasmic space; extracellular region; fungal-type cell wall
4-phytase activity acid phosphatase activity
Candida albicans
Disulfide bond Glycoprotein Hydrolase Reference proteome Secreted Virulence
MVSVSKLINN
MVSVSKLINNGLLLTSQSVFQDVATPQQASVQQYNILNFLGGSAPYIQRNGYGISTDIPAGCEIAQIQLYSRHGERYPSKSNGKSLEAIYAKFKNYNGTFKGDLSFLNDYTYFVKDQSNYAKETSPKNSEGTYAGTTNALRHGAAFRAKYGSLYKENSTLPIFTSNSNRVHETSKYFARGFLGDDYEEGKTVKFNIISEDADVGANSLTPRSACSKNKESSSSTAKKYNTTYLNAIAERLVKPNPGLNLTTSDVNNLFSWCAYEINVRGSSPFCDLFTNEEFIKNSYGNDLSKYYSNGAGNNYTRIIGSVILNSSLELLK...
hyphal growth cell surface; cell wall-bounded periplasmic space; extracellular region; fungal-type cell wall 4-phytase activity acid phosphatase activity Candida albicans Disulfide bond Glycoprotein Hydrolase Reference proteome Secreted Virulence MVSVSKLINN MVSVSKLINNGLLLTSQSVFQDVATPQQASVQQYNILNFLGGSAPYIQRNGYGISTDIPAG...
cellular response to nitrogen starvation nitrate import regulation of lateral root development regulation of leaf morphogenesis regulation of root development response to ammonium ion response to auxin response to nitrogen compound response to osmotic stress response to potassium ion root development
apoplast
hormone activity
Arabidopsis thaliana
Apoplast Developmental protein Direct protein sequencing Hormone Hydroxylation Reference proteome Secreted Signal
MKLLSITLTS
MKLLSITLTSIVISMVFYQTPITTEARSLRKTNDQDHFKAGFTDDFVPTSPGNSPGVGHKKGNVNVEGFQDDFKPTEGRKLLKTNVQDHFKTGSTDDFAPTSPGHSPGVGHKKGNVNVESSEDDFKHKEGRKLQQTNGQNHFKTGSTDDFAPTSPGNSPGIGHKKGHANVKGFKDDFAPTEEIRLQKMNGQDHFKTGSTDDFAPTTPGNSPGMGHKKGDDFKPTTPGHSPGVGHAVKNDEPKA
cellular response to nitrogen starvation nitrate import regulation of lateral root development regulation of leaf morphogenesis regulation of root development response to ammonium ion response to auxin response to nitrogen compound response to osmotic stress response to potassium ion root development apoplast hormone a...
de-etiolation response to far red light seed germination
membrane; perinuclear region of cytoplasm
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
Arabidopsis thaliana
Alternative splicing Cytoplasm Glycoprotein Hydrolase Membrane Reference proteome Transmembrane Transmembrane helix
MTGWYEFPVM
MTGWYEFPVMIGFVSAAVFLLISVAYLPLLNDLYWSTLKSLTPPAGIVADLLVTNGTIFTSDSSLPFADSMAIRNGRILKVGSFATLKGFIGDGTMEVNLEGKIVVPGLIDSHVHLISGGLQMAQVGLRGVSQKDEFCKMVKDAVQNAKEGSWILGGGWNNDFWGGELPSASWIDEISPRNPVWLIRMDGHMALANSLALKIAGVISLTEDPVGGTIMRMPSGEPTGLLIDAAMELVTPWVKEISVDERREALFRASKYALTRGVTTVIDLGRYFPGTTDELSWKDFQDVYLYADSSKKMMIRTCLFFPITTWSRLLDLK...
de-etiolation response to far red light seed germination membrane; perinuclear region of cytoplasm hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds Arabidopsis thaliana Alternative splicing Cytoplasm Glycoprotein Hydrolase Membrane Reference proteome Transmembrane Transmembrane helix MTGWYEFPVM MTG...
organonitrogen compound catabolic process
cytoplasm
2-iminobutanoate deaminase activity 2-iminopropanoate deaminase activity deaminase activity
Dermatophagoides farinae
Allergen Cytoplasm Direct protein sequencing Hydrolase
MSPKRIISTP
MSPKRIISTPLAPQPIGPYSQAVQVGNTVYLSGQIGMNVRTNEMVTGPIRDEAQQAFTNMKAVVEASGAKMSDVVKVNIFIRNFNDFPAINDVMKEFFQSPFPARSTVGVAELPKNARVEIESIVVIE
organonitrogen compound catabolic process cytoplasm 2-iminobutanoate deaminase activity 2-iminopropanoate deaminase activity deaminase activity Dermatophagoides farinae Allergen Cytoplasm Direct protein sequencing Hydrolase MSPKRIISTP MSPKRIISTPLAPQPIGPYSQAVQVGNTVYLSGQIGMNVRTNEMVTGPIRDEAQQAFTNMKAVVEASGAKMSDVVKVNIFIRNFN...
cell wall organization chitin catabolic process evasion of host immune response polysaccharide catabolic process
extracellular region
chitin binding chitin deacetylase activity metal ion binding
Pestalotiopsis sp
Carbohydrate metabolism Cell wall biogenesis/degradation Chitin degradation Chitin-binding Cobalt Disulfide bond Hydrolase Metal-binding Polysaccharide degradation Secreted Signal Virulence
MLAPLFAALL
MLAPLFAALLAGAATASPIQERQSSVPVGTIITACTVPNTFALTFDDGPFAYTSELLDLLSSNGVKATFFLNGQNWGSIYDYTSVVTRMDAEGHQIGSHTWSHADLATLDAAGITSQMTQLETALTSILGKVPTYMRPPYFSTNALALSTLGGLGYHVINANIDTLDYEHDDDTIGVAFTNFQNGLASGGTVSLMHDVHAQTVHVLVQEAINAIKAKGLTPVTVGTCLGDASANWYKSGGGSGTTPPPATGGPSPDDTCGGSNGYVCQNSQCCSQWGWCGTTSEYCAAGCQAAYGPCT
cell wall organization chitin catabolic process evasion of host immune response polysaccharide catabolic process extracellular region chitin binding chitin deacetylase activity metal ion binding Pestalotiopsis spCarbohydrate metabolism Cell wall biogenesis/degradation Chitin degradation Chitin-binding Cobalt Disulfide ...
arachidonic acid secretion lipid catabolic process phospholipid metabolic process
extracellular region
metal ion binding phospholipase A2 activity
Hemiscorpius lepturus
Calcium Cleavage on pair of basic residues Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Lipid degradation Lipid metabolism Metal-binding Secreted Signal Zymogen
MTFLILTILA
MTFLILTILATVTPSLYSHVVQRELRVNFEPLAGQRDSWPVARAAMVTFDARSEKAREFSECRMINSMHELSRELMDSPEHTVKRASKEEMDDLVQRCSGSAEGRSWFIWPDTKWCGPGTDAKNESDLGPLEADKCCRTHDHCDYIGAGETKYGLTNKSFFTKLNCKCEAAFDQCLKESIDRAEGSAKSSMEGLHSFYFNTYSPECYEVKCSRKRDAECTNGIAIWKDSYKS
arachidonic acid secretion lipid catabolic process phospholipid metabolic process extracellular region metal ion binding phospholipase A2 activity Hemiscorpius lepturus Calcium Cleavage on pair of basic residues Direct protein sequencing Disulfide bond Glycoprotein Hydrolase Lipid degradation Lipid metabolism Metal-bin...
killing of cells of another organism lipid catabolic process
extracellular region
lyase activity metal ion binding phosphoric diester hydrolase activity toxin activity
Hemiscorpius lepturus
Cytolysis Dermonecrotic toxin Disulfide bond Hemolysis Lipid degradation Lipid metabolism Lyase Magnesium Metal-binding Secreted Signal Toxin Zymogen
MAHCYYNSKR
MAHCYYNSKRGCNRVMKTVALVVLISTVMVEESRGDSQEDKKRPIWNIGHMVNAVKQIEEFLDLGANALEADVTFDDNGNPKWTYHGTPCDCFRDCLRWEYVDEYLKRIRELTSPGSSKFRKGFILLMLDLKISKLSDNAKSKAGKEIADMIIKRLWSGSGEKAQLYIVLSFPYVNDIEFVRAFRERVKSKGFASEAEKRIGWDISGNEDLGKIRDAYQKLGITDNVWQSDGITNCLTRSHDRLAEAVCKRDSDKEWPSLKKVYYWTVDKQSSMKEALKVGVDGMITNDPDDLVAVLNEFSGTHRLANINDSPWQKIPRP...
killing of cells of another organism lipid catabolic process extracellular region lyase activity metal ion binding phosphoric diester hydrolase activity toxin activity Hemiscorpius lepturus Cytolysis Dermonecrotic toxin Disulfide bond Hemolysis Lipid degradation Lipid metabolism Lyase Magnesium Metal-binding Secreted S...
chromosome organization viral DNA genome packaging
viral terminase, large subunit
ATP binding ATP hydrolysis activity endonuclease activity metal ion binding
Thermus phage G20c
3D-structure ATP-binding Endonuclease Hydrolase Magnesium Metal-binding Nuclease Nucleotide-binding Viral genome packaging Viral release from host cell
MKRLRPSDKF
MKRLRPSDKFFELLGYKPHHVQLAIHRSTAKRRVACLGRQSGKSEAASVEAVFELFARPGSQGWIIAPTYDQAEIIFGRVVEKVERLSEVFPTTEVQLQRRRLRLLVHHYDRPVNAPGAKRVATSEFRGKSADRPDNLRGATLDFVILDEAAMIPFSVWSEAIEPTLSVRDGWALIISTPKGLNWFYEFFLMGWRGGLKEGIPNSGINQTHPDFESFHAASWDVWPERREWYMERRLYIPDLEFRQEYGAEFVSHSNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFSVLDLDTGAIACLERM...
chromosome organization viral DNA genome packaging viral terminase, large subunit ATP binding ATP hydrolysis activity endonuclease activity metal ion binding Thermus phage G20c 3D-structure ATP-binding Endonuclease Hydrolase Magnesium Metal-binding Nuclease Nucleotide-binding Viral genome packaging Viral release from h...
gluconeogenesis glycolytic process methylglyoxal biosynthetic process
cytoplasm
IgE binding methylglyoxal synthase activity protein homodimerization activity triose-phosphate isomerase activity
Scylla paramamosain
3D-structure Allergen Cytoplasm Gluconeogenesis Glycolysis IgE-binding protein Isomerase Lyase
MANQRKFFVG
MANQRKFFVGGNWKMNGDKAAIDGIISFMKGPLNADTEVVVGCPQCYLMYTREHMPANIGVAAQNCYKTAKGAFTGEISPAMIKDCGCEWVILGHSERRNVFGEPDQLISEKVGHALEAGLKVIPCIGEKLEERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTATPEQAQDVHAKLRQWLRDNVSPQVAESTRIIYGGSVSAGNCKELAKTGDIDGFLVGGASLKPDFVTIINARA
gluconeogenesis glycolytic process methylglyoxal biosynthetic process cytoplasm IgE binding methylglyoxal synthase activity protein homodimerization activity triose-phosphate isomerase activity Scylla paramamosain 3D-structure Allergen Cytoplasm Gluconeogenesis Glycolysis IgE-binding protein Isomerase Lyase MANQRKFFVG ...
seed maturation
extraorganismal space
IgE binding nutrient reservoir activity
Juglans nigra
Allergen Direct protein sequencing Disulfide bond Seed storage protein Signal Storage protein
MAKPILLSIS
MAKPILLSISLCLVALVNGCLAQSGGRQQPRFGECKLKRLVALEPSNRIEAEAGVIESWDPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLLYIVKGRGITGVLFPGCPETFEESQQGQSRIRPSLRSASFQRDRHQKIRHFREGDVIAFPAGVAHWCYNDGDTPVVAVALMDTTNNANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRHGEPGQQQRGSGNNVFSGFDADFLADAFNVDTETARRLQSENDHRRSIVRVEGRQLQVIRPRWSREEQEREERKERERERESESERRQSRRGGRDDNGL...
seed maturation extraorganismal space IgE binding nutrient reservoir activity Juglans nigra Allergen Direct protein sequencing Disulfide bond Seed storage protein Signal Storage protein MAKPILLSIS MAKPILLSISLCLVALVNGCLAQSGGRQQPRFGECKLKRLVALEPSNRIEAEAGVIESWDPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLLYIVKGRGITGVLFPGCPETFEESQQGQ...
diterpenoid biosynthetic process
chloroplast
magnesium ion binding terpene synthase activity
Pseudolarix amabilis
Chloroplast Lyase Magnesium Metal-binding Plastid Transit peptide
MSRFTSATHG
MSRFTSATHGLNLSIKMPISVSQVPSIRSNTSKYELQKLRSTGRSVLQTRRQLAIINMTKRSEADDNDGVERRKGVFHPNLWDDGFIQSLSTVYHEQASYRERAERLIGEVKAVFDSISMGDGDQFISPSAYDTAWVARVPAIDGSSRPQFPQAIDWILLNQQQDGSWGSQSHLSLTHRLTDTLACVIALASWKIESVQIDEGLDFITRGVEKLQSESVPAEFEIIFAELLNQAKSLQLSLPYEHSCLQSLWRKQEPILANGLMDSVAKRSLSSLEEMQDHRMNTDSDGTMHVESFLSSPAVAARVLMRTGNPICLAYLN...
diterpenoid biosynthetic process chloroplast magnesium ion binding terpene synthase activity Pseudolarix amabilis Chloroplast Lyase Magnesium Metal-binding Plastid Transit peptide MSRFTSATHG MSRFTSATHGLNLSIKMPISVSQVPSIRSNTSKYELQKLRSTGRSVLQTRRQLAIINMTKRSEADDNDGVERRKGVFHPNLWDDGFIQSLSTVYHEQASYRERAERLIGEVKAVFDSISMGDGDQFIS...
response to zinc ion
NMDA selective glutamate receptor complex; plasma membrane; postsynaptic membrane
metal ion binding NMDA glutamate receptor activity
Xenopus laevis
3D-structure Alternative splicing Calcium Cell membrane Disulfide bond Glycoprotein Ion channel Ion transport Ligand-gated ion channel Magnesium Membrane Metal-binding Postsynaptic cell membrane Receptor Reference proteome Signal Synapse Transmembrane Transmembrane helix Transport Zinc
MGTMRLFLLA
MGTMRLFLLAVLFLFSFARAGCDPKIVNIGAVLSTKKHEQIFREAVNQANKRHFTRKIQLNATSVTHRPNAIQMALSVCEDLISSQVYAILVSHPPAPTDHLTPTPISYTAGFYRIPVIGLTTRMSIYSDKSIHLSFLRTVPPYSHQALVWFEMMRLFNWNHVILIVSDDHEGRAAQKKLETLLEEKESKADKVLQFEPGTKNLTALLLEAKELEARVIILSASEDDATAVYKSAAMLDMTGAGYVWLVGEREISGSALRYAPDGIIGLQLINGKNESAHISDAVAVVAQAIHELFEMENITDPPRGCVGNTNIWKTGPL...
response to zinc ion NMDA selective glutamate receptor complex; plasma membrane; postsynaptic membrane metal ion binding NMDA glutamate receptor activity Xenopus laevis 3D-structure Alternative splicing Calcium Cell membrane Disulfide bond Glycoprotein Ion channel Ion transport Ligand-gated ion channel Magnesium Membra...
pexophagy protein import into peroxisome matrix, receptor recycling protein import into peroxisome matrix, substrate release protein import into peroxisome matrix, translocation
cytosol; peroxisomal matrix
peroxisome matrix targeting signal-1 binding protein carrier chaperone
Xenopus laevis
Cytoplasm Isopeptide bond Peroxisome Protein transport Receptor Reference proteome Repeat Thioester bond TPR repeat Translocation Transport Ubl conjugation
MAMRGLIEAE
MAMRGLIEAECGGSNPLMKLTNHFTQDKALREEGLQHVSWPPGATVVSKPLGEATEDELVSEFLHTRAPSLQSRAPHTFKMDGLLAEMQEIEQSSFRPEPLRAPGVADLALSEQWSAEFLGVEVDPVEEEDWSREFTEQADPHASPSRWAEEYLQQSEEKLWLGESEGAMAEKWTEEYQPEDDLQREAKSLVSQVTDPKLANTQFLQFVKRIGDGELSFSHAPSTPSQTVSQAEQWSEQFVHEQAEQWVDQFAPLEKDFEKAKAAVESDVDFWDKLQEEWEEMAKRDAEAHPWLSDFQDLSSKSIDKGYMFEDNNPFSEV...
pexophagy protein import into peroxisome matrix, receptor recycling protein import into peroxisome matrix, substrate release protein import into peroxisome matrix, translocation cytosol; peroxisomal matrix peroxisome matrix targeting signal-1 binding protein carrier chaperone Xenopus laevis Cytoplasm Isopeptide bond Pe...
DNA damage response protein autoprocessing protein-DNA covalent cross-linking repair proteolysis
chromatin; nucleus
double-stranded DNA binding metal ion binding metalloendopeptidase activity single-stranded DNA binding
Xenopus laevis
Autocatalytic cleavage Chromosome DNA damage DNA repair Hydrolase Isopeptide bond Metal-binding Metalloprotease Nucleus Protease Reference proteome Repeat Zinc Zinc-finger
MGDMQMSVVD
MGDMQMSVVDPTWELLDPNPDIRALFLEFNDTFFWGQLSGVEVKWSARMTLCAGVCSYEGRGGLCSIRLSEPLLKLRPRKDLVETLLHEMIHALLFVTHNNKDHDSHGPEFCKHMERINGRTGANISVYHNFHDEVDEYRKHWWLCNGPCQKRKPYFGYVKRAMNRAPSSLDPWWADHQRTCGGSFVKVKEPENYPQKRKRKNDPTISEVNSSSHVKGKSNGVDIRTVIPFSGTGYKLFEPNKSDAPLKILNINPTKDKAAVPLLNHTPPSTNINGTFLTNKIGSAKSTPAQSILTKVSVANTKVFINLNGSPIKLPSGS...
DNA damage response protein autoprocessing protein-DNA covalent cross-linking repair proteolysis chromatin; nucleus double-stranded DNA binding metal ion binding metalloendopeptidase activity single-stranded DNA binding Xenopus laevis Autocatalytic cleavage Chromosome DNA damage DNA repair Hydrolase Isopeptide bond Met...
base-excision repair interstrand cross-link repair
chromosome; nucleoplasm
class I DNA-(apurinic or apyrimidinic site) endonuclease activity damaged DNA binding DNA N-glycosylase activity DNA-(apurinic or apyrimidinic site) endonuclease activity MCM complex binding zinc ion binding
Xenopus laevis
Chromosome DNA damage DNA repair DNA-binding Glycosidase Hydrolase Lyase Metal-binding Multifunctional enzyme Nucleus Reference proteome Repeat Zinc Zinc-finger
MEALPPQVLK
MEALPPQVLKPLDCMSIYSRHREPENRHNELSTGRCGRGHVIFSSMKALQPQVLKPTGSHANLQQVLYAPAATIITAPASSHNDLSSLTGCSYAGVETLGKELFIYFGLKAMRVHFGMNGSMRINQPMKKGQENGRPIPIAVLEVQLTKDLICFYESTVDVRNASECQEKIRFFEELDVCSSKFSFPRAECEIKKQRTRMLCDILLDQMILPGVGNIIKNEALFDSGLHPGVQAGLLTDEQVSHLVKMTRDFTLLFYKCRKSGSALYKHYKVYKRPNCGQCGTKITVCRLGEHNRMTYFCPKCQKDKPQHVDVSKLPTRN...
base-excision repair interstrand cross-link repair chromosome; nucleoplasm class I DNA-(apurinic or apyrimidinic site) endonuclease activity damaged DNA binding DNA N-glycosylase activity DNA-(apurinic or apyrimidinic site) endonuclease activity MCM complex binding zinc ion binding Xenopus laevis Chromosome DNA damage ...
deoxyribonucleoside monophosphate biosynthetic process phosphorylation
nucleus
ATP binding deoxyadenosine kinase activity deoxycytidine kinase activity deoxyguanosine kinase activity
Xenopus laevis
ATP-binding Kinase Nucleotide-binding Nucleus Reference proteome Transferase
MATPPKRICI
MATPPKRICIDVPASPSGNKCKVKRISIEGNIAAGKSTFVNILKKANEEWDVVPEPIARWCNIQSCKDEFEELTTSQKSGGNLLQMMYEKPERWSFTFQSYACLSRIRAQLKALGGKLKEAENPVLFFERSVYSDRYIFASNLYEAECMNETEWTVYQDWHDWMNSQFGADLELDGIIYLRAIPEKCLNRVYTRGREEEQGIPMEYLEKLHYKHETWLHHRTLRTDFEYLQEIPILTLDVNEDFRDNKQKQESLIEKVKEFLSTL
deoxyribonucleoside monophosphate biosynthetic process phosphorylation nucleus ATP binding deoxyadenosine kinase activity deoxycytidine kinase activity deoxyguanosine kinase activity Xenopus laevis ATP-binding Kinase Nucleotide-binding Nucleus Reference proteome Transferase MATPPKRICI MATPPKRICIDVPASPSGNKCKVKRISIEGNIAA...
response to ethylene response to jasmonic acid response to salicylic acid response to salt stress response to water deprivation
apoplast; plasma membrane
LRR domain binding receptor serine/threonine kinase binding
Arabidopsis thaliana
Apoplast Cell membrane Cleavage on pair of basic residues Membrane Reference proteome Secreted Signal
MTKNMTKKKM
MTKNMTKKKMGLMSPNIAAFVLPMLLVLFTISSQVEVVESTGRKLSWAFNGAPIVFTPPSSSCGGSPAAVMASEWMPRRPCRRTRPPGTNIPVSQSP
response to ethylene response to jasmonic acid response to salicylic acid response to salt stress response to water deprivation apoplast; plasma membrane LRR domain binding receptor serine/threonine kinase binding Arabidopsis thaliana Apoplast Cell membrane Cleavage on pair of basic residues Membrane Reference proteome...
microtubule depolymerization microtubule severing regulation of unidimensional cell growth
cytoplasm; katanin complex; microtubule; microtubule cytoskeleton
microtubule binding
Arabidopsis thaliana
Cytoplasm Cytoskeleton Microtubule Reference proteome Repeat WD repeat
MAKRGYKLQE
MAKRGYKLQEFVAHSGNVNCLSIGKKTSRLLLTGGDDYKVNLWSIGKTTSPMSLCGHTSPVDSVAFNSEEVLVLAGASSGVIKLWDLEESKMVRAFTGHRSNCSAVEFHPFGEFLASGSSDTNLRVWDTRKKGCIQTYKGHTRGISTIEFSPDGRWVVSGGLDNVVKVWDLTAGKLLHEFKCHEGPIRSLDFHPLEFLLATGSADRTVKFWDLETFELIGTTRPEATGVRAIAFHPDGQTLFCGLDDGLKVYSWEPVICRDGVDMGWSTLGDFCINEGKFIGCSYYRNSVGIWVSDISELEPYGAVSEDKNECMVKRFSV...
microtubule depolymerization microtubule severing regulation of unidimensional cell growth cytoplasm; katanin complex; microtubule; microtubule cytoskeleton microtubule binding Arabidopsis thaliana Cytoplasm Cytoskeleton Microtubule Reference proteome Repeat WD repeat MAKRGYKLQE MAKRGYKLQEFVAHSGNVNCLSIGKKTSRLLLTGGDDYKV...
defense response negative regulation of protein transport plasmodesmata-mediated intercellular transport positive regulation of defense response to virus by host regulation of cytoskeleton organization transport of virus in host, cell to cell
cytoplasm; microtubule cytoskeleton
microtubule binding RNA binding
Nicotiana tabacum
Alternative splicing Coiled coil Cytoplasm Cytoskeleton Host-virus interaction Plant defense Reference proteome RNA-binding
MYKPQQQQQL
MYKPQQQQQLFDLQDNNGAAFDNGGTDPSCWLSHENEISRTDSSLSSSNVDPLLFNDLVQIVPLVQSLIDRKEKSSFTRRGSMTYTKMPSRESLYKKTSEVKGRNAGQSTATKKHRDQNKNVSSSQDGYAENFSTPSSTSSLTEKDREELMTLREKVEDLQKKLLEKDELLKEAEILKNEITATNAELDEMKKDISEKDFLVKTTQVQLSDALVKLADKKAAVEKLEWEAMTSSKKVERLQEDLDLLQGEISSFIQFVHALTGNDSRDSAEECNVIPYPWDQNVEIDKLNERDLQKMEAAREAYIAAVAAAKENPDEASL...
defense response negative regulation of protein transport plasmodesmata-mediated intercellular transport positive regulation of defense response to virus by host regulation of cytoskeleton organization transport of virus in host, cell to cell cytoplasm; microtubule cytoskeleton microtubule binding RNA binding Nicotiana...
alkaloid metabolic process arginine catabolic process nicotine biosynthetic process spermidine biosynthetic process
chloroplast
arginine decarboxylase activity
Nicotiana tabacum
Alkaloid metabolism Chloroplast Decarboxylase Lyase Magnesium Plastid Pyridoxal phosphate Reference proteome Spermidine biosynthesis Transit peptide
MPALGCCVDA
MPALGCCVDAAVSPPPGYSFLWDSSLPAPEIFPSGVPPSTNTAVATTTTTHWSPAHSSALYSIDGWGAPYFTVNSSGDISVKPHGTDTLPHQEIDLLKVVKKASDPKNLGGLGLQFPLVVRFPDILKNRLESLQSVFDYAVQSQGYEAHYQGVYPVKCNQDRFVVEDIVKFGSGFRFGLEAGSKPELLLAMSCLCKGSHEGLLVCNGFKDAEYISLALVARKLMLNTVIVLEQEEELDLVIDISKKMAVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVKKLEESGMLDCLQLLHFHIGSQIPSTALLADG...
alkaloid metabolic process arginine catabolic process nicotine biosynthetic process spermidine biosynthetic process chloroplast arginine decarboxylase activity Nicotiana tabacum Alkaloid metabolism Chloroplast Decarboxylase Lyase Magnesium Plastid Pyridoxal phosphate Reference proteome Spermidine biosynthesis Transit p...
defense response intracellular signal transduction phosphorylation
cytoplasm; nucleus
ATP binding MAP kinase activity protein serine kinase activity protein serine/threonine kinase activity protein tyrosine kinase activity
Nicotiana tabacum
ATP-binding Kinase Nucleotide-binding Plant defense Reference proteome Serine/threonine-protein kinase Transferase
MDGSGQQTDT
MDGSGQQTDTMMSDAGAEQPPPAPQPVAGMDNIPATLSYGGRFIQYNIFGNIFEVTAKYKPPILPIGKGAYGIVCSALNSETIENVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENIVAIRDIIPPPQREAFNDVYIAYELMDTDLHQIIRSNQGLSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDIWSVGCIFTELMDRKPLFPGRDHVHQLRLIMELIGTPSEAEMEFLNENAKRYIRQLPLYRRQSFTEKFPHVHPAAID...
defense response intracellular signal transduction phosphorylation cytoplasm; nucleus ATP binding MAP kinase activity protein serine kinase activity protein serine/threonine kinase activity protein tyrosine kinase activity Nicotiana tabacum ATP-binding Kinase Nucleotide-binding Plant defense Reference proteome Serine/t...
alkaloid metabolic process nicotine biosynthetic process polyamine biosynthetic process putrescine biosynthetic process from ornithine response to wounding tyramine biosynthetic process
chloroplast; cytoplasm
ornithine decarboxylase activity
Nicotiana tabacum
Alkaloid metabolism Chloroplast Lyase Plastid Pyridoxal phosphate Reference proteome Transit peptide
MAGQTIIVSG
MAGQTIIVSGLNPAAILQSTIGGGASPTAAAAENGTRKVIPLSRDALQDFMLSIITQKLQDEKQPFYVLDLGEVVSLIDQWKSALPNIRPFYAVKCNPEPSFLSILSAMGSNFDCASRAEIEYVLSLGISPDRIVFANPCKPESDIIFAAKVGVNLTTYDSEDEVYKIRKHHPKSELLLRIKPMFDGNARCPMGPKYGALPEEVEPLLRAAQAARLTVSGVSFHIGSGDADSNAYLGAIAAAKEVFETAAKLGMSKMTVLDVGGGFTSGHQFTTAAVAVRSALKQHFDDQPELTIIAEPGRFFAETAFTLATTIIGKRVR...
alkaloid metabolic process nicotine biosynthetic process polyamine biosynthetic process putrescine biosynthetic process from ornithine response to wounding tyramine biosynthetic process chloroplast; cytoplasm ornithine decarboxylase activity Nicotiana tabacum Alkaloid metabolism Chloroplast Lyase Plastid Pyridoxal phos...
proteolysis
endoplasmic reticulum
metallocarboxypeptidase activity zinc ion binding
Aedes aegypti
3D-structure Carboxypeptidase Disulfide bond Endoplasmic reticulum Glycoprotein Hydrolase Metal-binding Metalloprotease Protease Reference proteome Signal Zinc Zymogen
MIPRIVVVLL
MIPRIVVVLLSVLAVVTARRSYEGYKVYGIVPESPDEAEILYQIRQSNPDLDFWHLTKQPGDEARVLVAPKDQRSFLIKLIRHGLHYQEVISDVEGTLAPYNEPRTRGMSLDRDVSTSYLRHNEINEYLQTLSQKYPSLVSVEEAGTSYEGRSIKTITINKKPGNAVVFLDAGIHAREWIAPATALYAIEQLVEHSSENQEVLSNLTWVIMPVVNPDGYEFSHETDRFWRKTRKPTGKTCKGTDGNRNFDYHWGEVGASTQACADTFRGETAFSEPETRAVRDAVMKLKGSCKFYLSLHSYGNYILYPWGWTSKLPETWE...
proteolysis endoplasmic reticulum metallocarboxypeptidase activity zinc ion binding Aedes aegypti 3D-structure Carboxypeptidase Disulfide bond Endoplasmic reticulum Glycoprotein Hydrolase Metal-binding Metalloprotease Protease Reference proteome Signal Zinc Zymogen MIPRIVVVLL MIPRIVVVLLSVLAVVTARRSYEGYKVYGIVPESPDEAEILY...
defense response to bacterium defense response to symbiont innate immune response positive regulation of melanization defense response proteolysis
extracellular space
serine-type endopeptidase activity
Anopheles gambiae
Disulfide bond Glycoprotein Hydrolase Immunity Innate immunity Protease Reference proteome Secreted Serine protease Signal Zymogen
MCILTLVERK
MCILTLVERKHLKNMVHVRLLVMMHILIIYSTFGAVRRPINIRVLEGNSCDTPQVIGGKCMNISLCDPAFVHSIAYQEHTPVCQQNAFYRVICCQPFLDFCENSKQFQIMHGIEAEPGMFPHLARLGLKSEEDGIAWTCSANIISERFLLTAAHCNPVNIAGLGCAESMQCDQQNTVKSFISNPKYKTSFKYHDIALVELEQNIRFNKRVLPICPYISKTDLHESEDLVIAGWGATESHFQSPRLMFATVRTVLQNDCKDHYASLLKASPNKKLHQGITDEMYCAQGALVDNVTEYIDACSGDSGGPLQTKQNNNLYLIG...
defense response to bacterium defense response to symbiont innate immune response positive regulation of melanization defense response proteolysis extracellular space serine-type endopeptidase activity Anopheles gambiae Disulfide bond Glycoprotein Hydrolase Immunity Innate immunity Protease Reference proteome Secreted ...
defense response to bacterium innate immune response positive regulation of melanization defense response positive regulation of protein processing proteolysis
extracellular space
serine-type endopeptidase activity
Anopheles gambiae
Disulfide bond Glycoprotein Immunity Innate immunity Reference proteome Secreted Serine protease homolog Signal
MKVLLFCIVI
MKVLLFCIVISLTTLIASGQDIEEELRCPGGYCVSKYLCPNGTFIDDIKHAQTTQLIGLRAGLDIDDFDDCNDYLLVCCQSAPAPTATSTEKPATSDELIEPPPSTNLACGQANEGGLIYDLRNNETLSQYAEYPWVVYILALKKQEANSGDFVCGGTLIHSRLVVTTAHNTDGKTDLVARFGEWDISTTKEPFPQQDIDVAEVIKHPQYVFNPIQNDIALLVLAENVQYAAHIRPICLPQPTDEFVGQRCVSNGWGKERGVYANVMKKLTLPVIGRANCTRMLRYAGLGPFYTLREGFLCAGGEVAVDMCKGDGGSPLA...
defense response to bacterium innate immune response positive regulation of melanization defense response positive regulation of protein processing proteolysis extracellular space serine-type endopeptidase activity Anopheles gambiae Disulfide bond Glycoprotein Immunity Innate immunity Reference proteome Secreted Serine...
defense response to bacterium defense response to symbiont innate immune response positive regulation of melanization defense response positive regulation of protein processing proteolysis
extracellular space
serine-type endopeptidase activity
Anopheles gambiae
Disulfide bond Glycoprotein Immunity Innate immunity Reference proteome Secreted Serine protease homolog Signal
MPSWWCCCCL
MPSWWCCCCLVVLLYAQRMIVPSSAQNDGSDELQECPGGFCSPKYLCPNGTYNEANAQNQEIIMLRFGEEDVCQDYMQVCCSNATSMRYELVTNNEPVEYGCGISNPGGLIYQVEGNRTYAQYGEFPWVVAILEAFYSSNEQQFTYVGGGTLIHPRFVVTAAHIFNKTENLVASFGEWDMNRDENVYPKQNIDIDRTIIVHPEYNSVGLLNDIALAQLKQNVVYDKHIRPICLPNPTDRFDDQLCISTGWGIEALTSAYANVLKRVDLPVIARASCKKLFAETRLGPFFRLHKSVLCAGGEEGADMCDGDGGSGLACPNE...
defense response to bacterium defense response to symbiont innate immune response positive regulation of melanization defense response positive regulation of protein processing proteolysis extracellular space serine-type endopeptidase activity Anopheles gambiae Disulfide bond Glycoprotein Immunity Innate immunity Refer...
antibacterial innate immune response defense response to bacterium defense response to symbiont positive regulation of melanin biosynthetic process positive regulation of melanization defense response positive regulation of protein processing proteolysis
extracellular region; extracellular space
serine-type endopeptidase activity
Anopheles gambiae
Disulfide bond Glycoprotein Immunity Innate immunity Reference proteome Secreted Serine protease homolog Signal
MAFSLRIGIR
MAFSLRIGIRTTDSKRCLVLLVLVVLLTVLACLPPSVEGNFPVGKFRRCNNNKGICVSREQCLNGQINTVGHTQIEPRLLNDDDIDECDVYGMQCCNLPSTNVPADSDEEEQEEEEKEKKGGTVTTTTTEEPDDPDWSRQCGQRTDVTERADQDGETNRFEFPWSVALFSKAQFFGKVRKEFLCGGTLIDDYLVLTAARCVNQKDRNTLVVQLGRWNLDAGKESRMQEIAVEELIIHRGYVLSSHLHNVALLVLANGAQLGRAANRVCLPDHSVQFGPDTLCYVVGWSNSPSPNTSNRQLKLRSMVAPVQECTATIRRST...
antibacterial innate immune response defense response to bacterium defense response to symbiont positive regulation of melanin biosynthetic process positive regulation of melanization defense response positive regulation of protein processing proteolysis extracellular region; extracellular space serine-type endopeptida...
diterpenoid biosynthetic process
chloroplast
isomerase activity magnesium ion binding terpene synthase activity
Salvia divinorum
Chloroplast Isomerase Magnesium Metal-binding Plastid Transit peptide
MSFATSLPRP
MSFATSLPRPTTTGAAGFGLPLATCISLSVSHSFSPKFGICNNTSLRLKSKAGSGCYEGIHRSQLAASTILEGHTPINPEVESEKIRLIERIRLMFRSMDDGEISVSPYDTAWVALVEDIGGSGGPQFPTSLEWISNNQLDDGSWGDRKFVLYDRILNTLACVVALTTWKMHPNKCEKGLRFISDNIEKLADEDEELMPVGFEIALPSLIDLAKRLCIEIPDNSASIKNIYAKRDSKLKRIPMDLMHKKPTSLLFSLEGMEGLNWDKLLDFQSEGSFLSSPSSTAYALHHTKDELCLEYLLKAVKKFNGGVPNAYPVDMF...
diterpenoid biosynthetic process chloroplast isomerase activity magnesium ion binding terpene synthase activity Salvia divinorum Chloroplast Isomerase Magnesium Metal-binding Plastid Transit peptide MSFATSLPRP MSFATSLPRPTTTGAAGFGLPLATCISLSVSHSFSPKFGICNNTSLRLKSKAGSGCYEGIHRSQLAASTILEGHTPINPEVESEKIRLIERIRLMFRSMDDGEISVSPY...
carbohydrate metabolic process central nervous system myelination central nervous system neuron axonogenesis ganglioside biosynthetic process via lactosylceramide glycoprotein biosynthetic process glycosylation neuron maturation poly-N-acetyllactosamine biosynthetic process positive regulation of embryonic development ...
Golgi apparatus; Golgi cisterna membrane
metal ion binding N-acetyllactosamine synthase activity UDP-galactose:glucosylceramide beta-1,4-galactosyltransferase activity
Sus scrofa
Disulfide bond Glycoprotein Glycosyltransferase Golgi apparatus Lipid biosynthesis Lipid metabolism Manganese Membrane Metal-binding Reference proteome Signal-anchor Sphingolipid metabolism Transferase Transmembrane Transmembrane helix
MRVRRGLLRL
MRVRRGLLRLPRRSLLAALFFFSLSSSLLYFVYVAPGIVNTYLFMMQAQGILIRDNMRTIGAQVYEQVVRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPSMKGPIDINMSEIGMDTIHELFSKDPAIKLGGHWKPSDCVPRWKVAILIPFRNRHEHLPVLLRHLIPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKDLDWDCLVFHDVDHIPENDRNYYGCGQMPRHFATKLDKYMYLLPYNEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPEGD...
carbohydrate metabolic process central nervous system myelination central nervous system neuron axonogenesis ganglioside biosynthetic process via lactosylceramide glycoprotein biosynthetic process glycosylation neuron maturation poly-N-acetyllactosamine biosynthetic process positive regulation of embryonic development ...
response to virus
cytoplasm; nucleus
RNA binding translation initiation factor activity
Capsicum annuum
Cytoplasm Disulfide bond Initiation factor Nucleus Protein biosynthesis RNA-binding Translation regulation
MATEAPPPVD
MATEAPPPVDTTEVPPFTAAETAVKQPHKLERKWTFWFDNQSKPKQGAAWGSSLKKAYTFDTVEEFWSLYDQIFKPSKLTVNADFHLFKAGIEPKWEDPECANGGKWTVTSSRKANLETMWLETLMALVGEQFDDSEDICGVVASVRRSQDKLSLWTKTATNEAAQMGIGRKWKEIIDTEKISYSFHDDSKRERSAKSRYTV
response to virus cytoplasm; nucleus RNA binding translation initiation factor activity Capsicum annuum Cytoplasm Disulfide bond Initiation factor Nucleus Protein biosynthesis RNA-binding Translation regulation MATEAPPPVD MATEAPPPVDTTEVPPFTAAETAVKQPHKLERKWTFWFDNQSKPKQGAAWGSSLKKAYTFDTVEEFWSLYDQIFKPSKLTVNADFHLFKAGIEPKWED...
defense response to virus translational initiation
cytoplasm; nucleus
RNA binding translation initiation factor activity
Capsicum annuum
Cytoplasm Disulfide bond Host-virus interaction Initiation factor Nucleus Plant defense Protein biosynthesis Reference proteome RNA-binding Translation regulation
MATAEMEKTT
MATAEMEKTTTFDEAEKVKLNANEADDEVEEGEIVEETDDTTSYLSKEIATKHPLEHSWTFWFDNPVAKSKQAAWGSSLRNVYTFSTVEDFWGAYNNIHHPSKLVVGADLHCFKHKIEPKWEDPVCANGGTWKMSFSKGKSDTSWLYTLLAMIGHQFDHEDEICGAVVSVRGKGEKISLWTKNAANETAQVSIGKQWKQFLDYSDSVGFIFHDDAKRLDRNAKNRYTV
defense response to virus translational initiation cytoplasm; nucleus RNA binding translation initiation factor activity Capsicum annuum Cytoplasm Disulfide bond Host-virus interaction Initiation factor Nucleus Plant defense Protein biosynthesis Reference proteome RNA-binding Translation regulation MATAEMEKTT MATAEMEKT...