uid stringlengths 6 10 | seq_fragment stringlengths 5 1.39k | annotation stringclasses 1
value | interpro_label int64 0 288 | correct_ipr stringclasses 259
values | correct_letter stringclasses 4
values | distractor_source stringclasses 3
values | option_a_ipr stringclasses 351
values | option_a_desc stringclasses 351
values | option_b_ipr stringclasses 335
values | option_b_desc stringclasses 335
values | option_c_ipr stringclasses 348
values | option_c_desc stringclasses 348
values | option_d_ipr stringclasses 339
values | option_d_desc stringclasses 339
values |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
O77737 | VKQALREAGDEFELR | Motif | 67 | IPR020728 | B | pool | IPR034233 | Nucleolin, RNA recognition motif 2 | IPR020728 | Apoptosis regulator, Bcl-2, BH3 motif, conserved site | IPR034856 | RBM12, RNA recognition motif 4 | IPR041993 | G-patch domain and KOW motifs-containing protein, KOW 1 |
P52272 | YRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSRGCAVVEFKMEESMKKAAEVLNKHSLSGRPLKVKEDPD | Motif | 5 | IPR000504 | B | pool | IPR056791 | Mcm10, C-terminal zinc binding motif | IPR000504 | RNA recognition motif domain | IPR006643 | Zasp-like motif | IPR013646 | Obg-like GTPase YGR210-like, G4 motif-containing domain |
P52272 | STVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKDGKSRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDER | Motif | 5 | IPR000504 | B | pool | IPR056791 | Mcm10, C-terminal zinc binding motif | IPR000504 | RNA recognition motif domain | IPR006643 | Zasp-like motif | IPR013646 | Obg-like GTPase YGR210-like, G4 motif-containing domain |
P52272 | CQIFVRNLPFDFTWKMLKDKFNECGHVLYADIKMENGKSKGCGVVKFESPEVAERACRMMNGMKLSGREIDVRIDRN | Motif | 5 | IPR000504 | B | pool | IPR056791 | Mcm10, C-terminal zinc binding motif | IPR000504 | RNA recognition motif domain | IPR006643 | Zasp-like motif | IPR013646 | Obg-like GTPase YGR210-like, G4 motif-containing domain |
Q6YZW2 | RSVYVGNVHPNVTESLLIEVFQSSGLVERCKLIRKEKSSFGFVDYYDRRSAALAIMTLHGRHICGQAIKVNWAYA | Motif | 5 | IPR000504 | D | pool | IPR037372 | Tripartite motif-containing protein 66, B-box type 1 zinc finger | IPR026179 | SLAIN motif-containing protein | IPR048559 | Disabled homolog 1/2, sulfatide-binding motif | IPR000504 | RNA recognition motif domain |
Q6YZW2 | FHIFVGDLSSEVNDATLYACFSAYPSCSDARVMWDNKTGRSRGYGFVSFRNQQEAETAITEMTGKWLGSRQIRCNWATK | Motif | 5 | IPR000504 | D | pool | IPR037372 | Tripartite motif-containing protein 66, B-box type 1 zinc finger | IPR026179 | SLAIN motif-containing protein | IPR048559 | Disabled homolog 1/2, sulfatide-binding motif | IPR000504 | RNA recognition motif domain |
Q6YZW2 | TTVYVGNLGHEVNRDELHRHFYNLGVGAIEEVRVQQDKGFGFVRYSNHGEAALAIQMANGLVVRGKPIKCSWGNK | Motif | 5 | IPR000504 | D | pool | IPR037372 | Tripartite motif-containing protein 66, B-box type 1 zinc finger | IPR026179 | SLAIN motif-containing protein | IPR048559 | Disabled homolog 1/2, sulfatide-binding motif | IPR000504 | RNA recognition motif domain |
Q1ZXC2 | SLYVGDLAADVNEIILNELFSKVGRNAIASIHVCRDSNTLRSLGYAYVNFFNNHDAERALDTLNYTLVHGKPCRIMWSYRDP | Motif | 146 | IPR034364 | D | hierarchy | IPR034843 | IGF2BP2, RNA recognition motif 1 | IPR034203 | RBM45, RNA recognition motif 1 | IPR034990 | hnRNPM, RNA recognition motif 3 | IPR034364 | PABP, RNA recognition motif 1 |
Q9LIE6 | SQFYNNNQTFFTTSTTASTAVTTTTAGDTTSIDSRLSPETGRVTKPTRRRSRASRRTPTTLLNTDTSNFRAMVQQYTGGPSAMAFGSGNTTSAFSLTSSSDPSAGSSQQAPWQYNFQPHAPLQPPQRPYMFSLNNVNPVVGYSNMNNPNTMVSGVFGTVDGSGGGGSA | Motif | 237 | IPR039609 | B | pool | IPR028671 | Syntaxin-2, SNARE motif | IPR039609 | VQ motif-containing protein 15/22 | IPR041994 | G-patch domain and KOW motifs-containing protein, KOW 2 | IPR034125 | RBM6, RNA recognition motif 2 |
O22137 | HKEFETGELVAKHLILQAGYNPSSYVLLSNMYASFGMWKDVRRVRTMMKERKIEKIPGCSWIE | Motif | 272 | IPR046848 | B | pool | IPR049059 | NAD-glutamate dehydrogenase, helical motif 1 | IPR046848 | E motif | IPR034371 | UHMK1, RNA recognition motif | IPR034932 | BRAP2, RNA recognition motif |
Q9LME6 | KRKRGRPRKIRNP | Motif | 56 | IPR017956 | A | pool | IPR017956 | AT hook, DNA-binding motif | IPR034146 | snRNP35, RNA recognition motif | IPR034278 | RBM3/CIRBP, RNA recognition motif | IPR019582 | RNA recognition motif, spliceosomal PrP8 |
Q9LME6 | KRKRGRPPKNKEE | Motif | 56 | IPR017956 | A | pool | IPR017956 | AT hook, DNA-binding motif | IPR034146 | snRNP35, RNA recognition motif | IPR034278 | RBM3/CIRBP, RNA recognition motif | IPR019582 | RNA recognition motif, spliceosomal PrP8 |
Q9CA73 | HGNVELGEEVQRRIFELDRDHVGDYVALSNIYASKGMWDEKSKMRDRVRKRRMPGKSWIE | Motif | 272 | IPR046848 | C | pool | IPR029369 | Domain of unknown function with conserved HDNR motif | IPR005108 | HELP motif | IPR046848 | E motif | IPR034191 | MARF1, RNA recognition motif 2 |
A6Q8H2 | DTVLKINGVGPKVGLAICST | Motif | 12 | IPR003583 | A | pool | IPR003583 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR031379 | CLLAC-motif containing domain | IPR005108 | HELP motif | IPR039184 | Sterile alpha and TIR motif-containing protein 1 |
A6Q8H2 | SMLKRVPGIGPKAASRILVE | Motif | 12 | IPR003583 | A | pool | IPR003583 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR031379 | CLLAC-motif containing domain | IPR005108 | HELP motif | IPR039184 | Sterile alpha and TIR motif-containing protein 1 |
A1A5R7 | STIYAGPFSKDCNVGSLKKVFSSLGPVQSITLVLETYRPYFSIQYELLEAAQLAIETMNGTILEGSCIRVHRLLT | Motif | 5 | IPR000504 | D | pool | IPR045848 | YKT6, SNARE motif | IPR031379 | CLLAC-motif containing domain | IPR040813 | Small RNA 2'-O-methyltransferase Hen1, La-motif C-terminal domain | IPR000504 | RNA recognition motif domain |
A1A5R7 | GTIYVAGIGETFKEHLLEQSNLFPDLEAVILPKELKSRKQKNYCFLKFKTFNSAQVALEVLKGKDWKLKGRNALTS | Motif | 5 | IPR000504 | D | pool | IPR045848 | YKT6, SNARE motif | IPR031379 | CLLAC-motif containing domain | IPR040813 | Small RNA 2'-O-methyltransferase Hen1, La-motif C-terminal domain | IPR000504 | RNA recognition motif domain |
Q56A08 | GHRVMVVLGPHAGKVGLLRSRDRAQSHALVQLRRENQVVELHYNAICQYMG | Motif | 253 | IPR041994 | B | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR041994 | G-patch domain and KOW motifs-containing protein, KOW 2 | IPR007166 | Class III signal peptide motif | IPR034451 | RNA-binding protein 27, RNA recognition motif |
Q4R4T6 | GNFADLGLEPRVLHALQEVAPEVVQPTTVQS | Motif | 49 | IPR014014 | D | pool | IPR010177 | Doubled CXXCH motif | IPR034979 | UPF3B, RNA recognition motif-like domain | IPR043937 | Golgin subfamily A , C-terminal binding motif | IPR014014 | RNA helicase, DEAD-box type, Q motif |
B3DWU2 | RLIFGLGIPHIGQKASEDLARYFGTMDKLSHATEEELLNLPFIGEIMARSIVNYFRKEANRR | Motif | 248 | IPR041663 | C | pool | IPR034823 | CID8-like protein, RNA recognition motif 1 | IPR024744 | Putative cyclic diguanylate phosphodiesterase, CSS motif-containing domain | IPR041663 | DisA/LigA, helix-hairpin-helix motif | IPR016611 | Mitochondrial intermembrane space cysteine motif-containing protein Mix14 |
Q10RI7 | AAFEDLKLTPELLKGLHDEMGFSRPSKIQA | Motif | 49 | IPR014014 | A | pool | IPR014014 | RNA helicase, DEAD-box type, Q motif | IPR000233 | Cadherin, Y-type LIR-motif | IPR012943 | Centrosomin, N-terminal motif 1 | IPR034536 | RBM15B, RNA recognition motif 3 |
A6ZSX1 | ESFSELNLVPELIQACKNLNYSKPTPIQS | Motif | 49 | IPR014014 | C | pool | IPR033110 | ROD1, RNA recognition motif 4 | IPR047942 | Ribonucleoprotein PTB-binding 2, RNA recognition motif 3 | IPR014014 | RNA helicase, DEAD-box type, Q motif | IPR034467 | Set1A, RNA recognition motif |
Q6ICX4 | PNRILLVTIHHMLYPITVDVLHQVFSPYGFVEKLVTFQKSAGFQALIQYQVQQCAASARTALQGRNIYDGCCQLDIQFSNLEELQVNY | Motif | 184 | IPR034796 | D | hierarchy | IPR034472 | RBM15, RNA recognition motif 2 | IPR034564 | U2 small nuclear ribonucleoprotein B'', RNA recognition motif 1 | IPR034211 | PUF60, RNA recognition motif 2 | IPR034796 | PTBPH3, RNA recognition motif 2 |
O43795 | RLEDLATLIQKIYRGWKCRTHFL | Motif | 1 | IPR000048 | C | pool | IPR033110 | ROD1, RNA recognition motif 4 | IPR006914 | VENN motif-containing domain | IPR000048 | IQ motif, EF-hand binding site | IPR034637 | Negative elongation factor E, RNA recognition motif |
O43795 | LMKKSQIVIAAWYRRYAQQKRYQ | Motif | 1 | IPR000048 | C | pool | IPR033110 | ROD1, RNA recognition motif 4 | IPR006914 | VENN motif-containing domain | IPR000048 | IQ motif, EF-hand binding site | IPR034637 | Negative elongation factor E, RNA recognition motif |
O43795 | QTKSSALVIQSYIRGWKARKILR | Motif | 1 | IPR000048 | C | pool | IPR033110 | ROD1, RNA recognition motif 4 | IPR006914 | VENN motif-containing domain | IPR000048 | IQ motif, EF-hand binding site | IPR034637 | Negative elongation factor E, RNA recognition motif |
O43795 | RCKEAVTTIAAYWHGTQARRELR | Motif | 1 | IPR000048 | C | pool | IPR033110 | ROD1, RNA recognition motif 4 | IPR006914 | VENN motif-containing domain | IPR000048 | IQ motif, EF-hand binding site | IPR034637 | Negative elongation factor E, RNA recognition motif |
O43795 | RNKHAIAVIWAYWLGSKARRELK | Motif | 1 | IPR000048 | C | pool | IPR033110 | ROD1, RNA recognition motif 4 | IPR006914 | VENN motif-containing domain | IPR000048 | IQ motif, EF-hand binding site | IPR034637 | Negative elongation factor E, RNA recognition motif |
O43795 | RRKHAVAVIWAYWLGLKVRREYR | Motif | 1 | IPR000048 | C | pool | IPR033110 | ROD1, RNA recognition motif 4 | IPR006914 | VENN motif-containing domain | IPR000048 | IQ motif, EF-hand binding site | IPR034637 | Negative elongation factor E, RNA recognition motif |
O70305 | VRKSTLNPNAKEFNPRS | Motif | 36 | IPR009818 | B | pool | IPR025527 | HUWE1/REV1, ubiquitin-binding motif | IPR009818 | PAM2 motif | IPR034591 | RBM12, RNA recognition motif 1 | IPR034564 | U2 small nuclear ribonucleoprotein B'', RNA recognition motif 1 |
Q9SVP7 | IHSFYVGDQNHPLADEIHEYFQDLTKR | Motif | 273 | IPR046849 | A | pool | IPR046849 | E2 motif | IPR045668 | FHF complex subunit HOOK-interacting protein, KELAA motif | IPR024929 | Nucleolar GTP-binding protein 2, circularly permuted GTPase motif | IPR029460 | DNA polymerase, helix-hairpin-helix motif |
Q56XI1 | HSQLDVAEFCAKKLIEIEPENSGTYILLSNMYASQGRWADVAELRKLMKTRLVRKSPGCSWTE | Motif | 272 | IPR046848 | B | pool | IPR039612 | VQ motif-containing protein 5/9/14 | IPR046848 | E motif | IPR034808 | Nop4, RNA recognition motif 3 | IPR019441 | FMP27/BLTP2/Hobbit, GFWDK motif-containing RBG unit |
Q9SZ70 | HARDFQLHLQQQQQHQQQHQQQQQQQFFLHHHQQPQRNLDQDHEQQGGSILNRSIKMDREETSDNMDNIANTNSGSEGKEMSLHGGEGGSGGGGSGEQMTRRPRGRPAGSKNKPKAPIIITRDSANALRTHVMEIGDGCDIVDCMATFARRRQRGVCVMSGTGSVTNVTIRQPGSPPGSVVSLHGRFEILSLSGSFLPPPAPPAATGLSVYLAGGQGQVVGGSVVGPLLCSGPVVVMAASFSNAAYERLPLEEDEMQTPVQGGGGGGGGGGGMGSPPMMGQQQAMAAMAAAQGLPPNLLGSVQLPPPQQNDQQYWSTGRP... | Motif | 50 | IPR014476 | A | pool | IPR014476 | AT-hook motif nuclear-localized protein 15-29 | IPR034930 | Matrin-3, RNA recognition motif 2 | IPR024759 | UvrB, YAD/RRR-motif-containing domain | IPR034260 | Yme2, RNA recognition motif |
A5CEJ4 | NMLQSVSGIGTKMALHILSN | Motif | 12 | IPR003583 | A | pool | IPR003583 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR046331 | GPALPP motifs-containing protein 1-like | IPR034992 | RNA-binding protein 10, RNA recognition motif 2 | IPR012943 | Centrosomin, N-terminal motif 1 |
A5CEJ4 | HQLKAISGVGPKLIDRLMIE | Motif | 12 | IPR003583 | A | pool | IPR003583 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR046331 | GPALPP motifs-containing protein 1-like | IPR034992 | RNA-binding protein 10, RNA recognition motif 2 | IPR012943 | Centrosomin, N-terminal motif 1 |
O60506 | QPSVGTEIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTFCTKEAAQEAVKLYNNHEIRSGKHIGVCISV | Motif | 172 | IPR034544 | C | hierarchy | IPR034419 | Probable RNA-binding protein 19, RNA recognition motif 3 | IPR034856 | RBM12, RNA recognition motif 4 | IPR034544 | Heterogeneous nuclear ribonucleoprotein Q, RNA recognition motif 1 | IPR034552 | p54nrb, RNA recognition motif 1 |
A6UDW8 | GVKVLPVDINHSDWDALLEGEGQFRKESVDPRHADMREVIKTRKAVRLGFRLVKGLKQADMGALVACRGEGYRSVHDLWFRSGLSRSVLERLADADAFRSLGLDRRA | Motif | 91 | IPR029460 | A | pool | IPR029460 | DNA polymerase, helix-hairpin-helix motif | IPR046793 | Cysteine protease ATG4, F-type LIR motif | IPR034914 | HuB, RNA recognition motif 3 | IPR038713 | Terminase small subunit, N-terminal DNA-binding domain, HTH motif superfamily |
Q6LA55 | GLKARVDNFTIDLHQRSEKHEVKNKANLGRKHQEATSMKVHLAEIDFKTIDLRAISASFDEGALDNSDSIPANVLDEEEKECFSFKNVDGPANWVDIDDYHEADWLLPQQNEKCSIYPLAFSPRFTYYRHTKCHRRNEKNEKEIIPDTCRFGDEFTHRCLMPSRENPKAVQYELLQKRRKELEEFMSSEQERIGFLKSQLESNNDSEEVRQEYEELTKRIVTLSDHYRLLEYLLKDESSCSQASQCSENGQVDLSYASLSESVHAFNNRFVAHNVQVKWNNFIRNAVMSYVHEVERVRGFAYYMSQKAIVFLRDLEKRTE... | Motif | 63 | IPR019449 | D | pool | IPR018892 | Retro-transposon transporting motif | IPR018334 | ArsR-type transcription regulator, HTH motif | IPR006914 | VENN motif-containing domain | IPR019449 | FMP27, WPPW motif-containing RBG unit |
Q9HEQ9 | FRVFVGRLSTSTKKSEIRSLFETVGTVRKVTIPFRRVRRGTRLVPSGIAFVTFNNQEDVDKAIETLNGKTLDDREIVVQKARP | Motif | 5 | IPR000504 | A | pool | IPR000504 | RNA recognition motif domain | IPR041994 | G-patch domain and KOW motifs-containing protein, KOW 2 | IPR015348 | Clathrin, heavy chain, linker, core motif | IPR040330 | LYR motif-containing protein 1 |
Q9HEQ9 | NSIYVSGLSVTLTNEGLKEMFDAYNPTRARIAVRSLPPYIIRRIKLRGEQRRGRGFGFVSFANAEDQSRAIEEMNGKQVGDLTLVVKSAVF | Motif | 5 | IPR000504 | A | pool | IPR000504 | RNA recognition motif domain | IPR041994 | G-patch domain and KOW motifs-containing protein, KOW 2 | IPR015348 | Clathrin, heavy chain, linker, core motif | IPR040330 | LYR motif-containing protein 1 |
Q9LNP2 | HKNVDIAEGIASQLSVLEPERTGSYMLLSNIYSAGGRWEESANVRALAKKKDLKKVSGSSWIE | Motif | 272 | IPR046848 | B | pool | IPR026179 | SLAIN motif-containing protein | IPR046848 | E motif | IPR000233 | Cadherin, Y-type LIR-motif | IPR034777 | Nop12, RNA recognition motif 1 |
Q04688 | DVKPVLNWVLDSKFKREQIRLKIPEAANEWTHAHVTYWLEWAVKQFELVGINMSDWQMNGQELCAMTHEEFNQKLPRDPGNIFWTHLQLLKECNFVS | Motif | 48 | IPR013761 | B | pool | IPR012899 | LTXXQ motif family protein | IPR013761 | Sterile alpha motif/pointed domain superfamily | IPR034264 | RBM48, RNA recognition motif | IPR037695 | IQ motif and ubiquitin-like domain-containing protein |
Q8SWQ4 | FVEGEFNNVKGVFIDQSYPLRIQCTNCGSPHEKSVVLSEDSVGEGDFGEKVNLSITCRCCRRIMTLKILKLKEGREVKKHLLPTNFEDEFKEVWLSDMQKSRFLVSRIETNGAEVTSIESCILNLVSNQDVLFTNVNFED | Motif | 32 | IPR008584 | C | pool | IPR018892 | Retro-transposon transporting motif | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 | IPR008584 | CXXC motif containing zinc binding protein, eukaryotic | IPR005108 | HELP motif |
Q4JXR6 | PGASAVIRCEDKHDGDIEYAGVNKAMAVEETNIYLFGKPRALARRRMGVAVATAENIDQARQRAEEAAGYIEV | Motif | 42 | IPR011054 | B | pool | IPR048559 | Disabled homolog 1/2, sulfatide-binding motif | IPR011054 | Rudiment single hybrid motif | IPR045844 | Ist3-like, RNA recognition motif | IPR034910 | LARP7, RNA recognition motif 2 |
Q12926 | GTGWCIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKTHK | Motif | 208 | IPR034914 | B | hierarchy | IPR034918 | HuD, RNA recognition motif 3 | IPR034914 | HuB, RNA recognition motif 3 | IPR034990 | hnRNPM, RNA recognition motif 3 | IPR034467 | Set1A, RNA recognition motif |
Q9FNN2 | RKSEFVRIITRALYSLGYDKTGAMLEEESGISL | Motif | 21 | IPR006594 | A | pool | IPR006594 | LIS1 homology motif | IPR034229 | eIF4H, RNA recognition motif | IPR047942 | Ribonucleoprotein PTB-binding 2, RNA recognition motif 3 | IPR010181 | CGCAxxGCC motif |
A6L5G8 | RRAMNIDGLGPETVDQFYQE | Motif | 12 | IPR003583 | B | pool | IPR033490 | Leucine-rich PPR motif-containing protein | IPR003583 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR034150 | SF3B6, RNA recognition motif | IPR034793 | PTBPH1/PTBPH2, RNA recognition motif 2 |
A6L5G8 | SDIINLERMGEKSAENIIKG | Motif | 12 | IPR003583 | B | pool | IPR033490 | Leucine-rich PPR motif-containing protein | IPR003583 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR034150 | SF3B6, RNA recognition motif | IPR034793 | PTBPH1/PTBPH2, RNA recognition motif 2 |
A6L5G8 | DNLIHVDEIGEKIAQSILLY | Motif | 12 | IPR003583 | B | pool | IPR033490 | Leucine-rich PPR motif-containing protein | IPR003583 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR034150 | SF3B6, RNA recognition motif | IPR034793 | PTBPH1/PTBPH2, RNA recognition motif 2 |
P50653 | KSSSEQLDSQTYPKLAAPSENPVEYFAHVEPGMFNTIVAKYNNGM | Motif | 39 | IPR010514 | A | pool | IPR010514 | COX aromatic rich motif | IPR043937 | Golgin subfamily A , C-terminal binding motif | IPR045347 | HIND motif | IPR056791 | Mcm10, C-terminal zinc binding motif |
P0C7M6 | KRVKAAGQIQAWWRGVLVRRTLL | Motif | 1 | IPR000048 | C | pool | IPR006643 | Zasp-like motif | IPR024744 | Putative cyclic diguanylate phosphodiesterase, CSS motif-containing domain | IPR000048 | IQ motif, EF-hand binding site | IPR006594 | LIS1 homology motif |
P0C7M6 | IQEQATVKLQSCIRMWQCRQCYR | Motif | 1 | IPR000048 | C | pool | IPR006643 | Zasp-like motif | IPR024744 | Putative cyclic diguanylate phosphodiesterase, CSS motif-containing domain | IPR000048 | IQ motif, EF-hand binding site | IPR006594 | LIS1 homology motif |
P37838 | PKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCRIALENTKDLKIDGRKVAVDFAVQKNRW | Motif | 188 | IPR034806 | B | hierarchy | IPR034914 | HuB, RNA recognition motif 3 | IPR034806 | Nop4, RNA recognition motif 2 | IPR034915 | HuC, RNA recognition motif 3 | IPR034411 | Heterogeneous nuclear ribonucleoprotein R, RNA recognition motif 2 |
Q80VG1 | PSPSPEVQDTRRPSSRNPSTWTVEDVVRFVKDADPEALGPHVELFRKHEIDGNALLLLRSDMIMKYLGLKLGPALKLCYHIDKLKQAK | Motif | 48 | IPR013761 | D | pool | IPR040330 | LYR motif-containing protein 1 | IPR020728 | Apoptosis regulator, Bcl-2, BH3 motif, conserved site | IPR043058 | KRIT, N-terminal NPxY motif-rich domain superfamily | IPR013761 | Sterile alpha motif/pointed domain superfamily |
Q8CIE4 | ALELRGLPPEIPDELITLYFENHRRSGGGLLLSWQRLGCGGVLIFQDPADAKRVLAQAEHRLHGVRLSLRP | Motif | 162 | IPR034464 | B | pool | IPR000233 | Cadherin, Y-type LIR-motif | IPR034464 | PARP-10, RNA recognition motif 1 and 2 | IPR034924 | TNRC6A, RNA recognition motif | IPR034880 | La-related protein 6, RNA recognition motif |
P62284 | RYLWATVTIQRHWRAYLRRKQDQ | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | MLKSSSLIIQAMFRRWKQRKMQL | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | KEEKSAIVIQSWYRMHKQLRKYV | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | YVRSCVVIIQKRFRCFQAQRLYK | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | RKRESILTIQKYYRAYLKGKIER | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | RPIRAACVIQSYWRMRQDRVRFL | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | NLKKNIIKLQAHVRKHQQLQKYK | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | KIKKAAVIIQTHFQAYIFARKVL | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | KTRSAVIVLQSAYRGMQARKMYI | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | HILTSVIKIQSYYRAYVSKKEFL | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | SLKNATIKLQSIVKMKQTRKQYV | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | QMRESCIKLQAFVRGYLVRKQIR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | LQRKAVISLQSYFRMRKARQYYL | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | KMYKAVIIIQNYYHSYKAQVNQR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | RVKKAATCLQAAYRGYKVRQLIK | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | QQSVAAVKIQSAFRGYSKRVKYL | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | SVLQSIIKIQRWYRAYKTLYDIRTRFL | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | KAKAAVISLQSAYRGWKVRKQIR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | REHQAAMKIQSAFRMAKAQKQFR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | LFKTAALVIQQHLRAWIAGRKQR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | ELRHSVLMLQSMWKGKTLRRDLQ | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | RQHTCAVIIQSYYRMHVQQKKWK | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | IMKEAALLIQKYYRACRIGREQH | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | ETKAAVLTLQSAYRGMKVRKRIK | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | ACNTAAITIQSKYRAYKTKKKYA | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | AYRASAIIIQRWYRGIKITNHQY | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | NLKKTAIKIQAVYRGIRVRRHIQ | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | HMHRAATFIKAMFKMHQPRIRYH | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | TMRKATIVIQVRYRAYHQGKMQR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | KILKAVNILQANFRGVRVRRTLR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | KLRIAATLIQSNYRRYRQQTYFN | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | KLRHSVIYIQALFRGMKARRHLK | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | TMHIAATLIQRRFRALMLRRRFL | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | RLQNAAIKIQSSYRRWMIRKKMR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | EMHRAAAFIQATFRMHRVHMRYH | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | RQRYSAVILQAAFRGMKTRRHLK | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | SAILIQSRFRSLLVRRRFI | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | QLRKAAITIQSSYRRLMVKKKLQ | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | EMHRAAVLIQATFRMHRTHITFQ | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | TWKHASILIQQHYRTYRASKLQR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | KQWHSAVIIQAAYRGMKARQLLR | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | EKHKAAIIIQSTYRMYRQYCLYQ | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | EQHQTSIIIQKHCKAFKIKKHYL | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | VHTQAVICIQSYYRGFKVRRDIQ | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
P62284 | NMHLAATRIQSFYRMHRAKVHYQ | Motif | 1 | IPR000048 | C | pool | IPR034192 | SREK1, RNA recognition motif 2 | IPR020726 | Apoptosis regulator, Bcl-2, BH2 motif, conserved site | IPR000048 | IQ motif, EF-hand binding site | IPR049058 | NAD-glutamate dehydrogenase, helical motif 2 |
VenusX Fragment MCQ — Motif (MF50)
4-choice multiple-choice question reformulation of the VenusX Fragment-level Motif sub-task from the paper VenusX: Unlocking Fine-Grained Functional Understanding of Proteins (ICLR 2026).
This fork adapts the original N-way classification task into a 4-choice MCQ so that zero-shot LLMs can be evaluated fairly. The original task required the model to output one of 289 InterPro class labels—infeasible for a CausalLM that cannot know which IPR IDs are in the benchmark's label subspace.
Schema
Each sample is one multiple-choice question with exactly one correct answer.
| Field | Type | Description |
|---|---|---|
uid |
str | Original VenusX sample UID |
seq_fragment |
str | The protein fragment amino acid sequence |
annotation |
str | "Motif" (sub-task name) |
interpro_label |
int | Original VenusX integer label (preserved for compatibility) |
correct_ipr |
str | The correct InterPro accession (e.g. IPR000169) |
correct_letter |
str | "A" / "B" / "C" / "D" — the letter whose option matches correct_ipr |
option_{a,b,c,d}_ipr |
str | InterPro accession for each option |
option_{a,b,c,d}_desc |
str | Human-readable description from InterPro entry.list |
distractor_source |
str | How the 3 distractors were picked: hierarchy, mixed, or pool (see below) |
How the MCQ is constructed
For each sample, we start with one golden InterPro ID (the original label) and pick 3 distractors via a 2-tier fallback:
- Tier 1 — InterPro hierarchy siblings: If the golden IPR is in the InterPro hierarchy tree, take true siblings (same parent, not the golden itself, not any ancestor/descendant of the golden). We use up to 3.
- Tier 2 — Same sub-task label pool (random): Fill the remaining slots by random sampling from the full label pool of the same sub-task, excluding the golden, all its ancestors/descendants, and any Tier 1 picks.
All 4 options (1 golden + 3 distractors) are then shuffled to randomize
letter positions (A/B/C/D), using a deterministic per-sample seed derived
from {annotation}:{split}:{uid}:{golden} so every dataset build is
bit-identical and reviewers can independently verify each MCQ.
The distractor_source column records which strategy was used:
hierarchy— all 3 distractors are InterPro siblingsmixed— some are siblings, some are random pool samplespool— all 3 are random pool samples (most common forActive_site/Binding_site/Conserved_sitetypes, which have no InterPro hierarchy per EBI convention)
Why descriptions are included
The original free-text task expected the LLM to directly output an IPR ID like
IPR019757. This is unfair because the LLM has no way to know which specific
IPRs are in the benchmark's small label subspace. Our MCQ format exposes the
4 candidate options with human-readable names (e.g.
IPR019757 — Peptidase S26A, signal peptidase I, lysine active site) so that
the LLM can use its biological knowledge to match the fragment's features
against the candidate functional descriptions.
Example
Fragment: IHCIAGLGRTP
A) IPR033694 — Pyroglutamyl peptidase I, Cys active site
B) IPR023411 — Ribonuclease A, active site
C) IPR016130 — Protein-tyrosine phosphatase, active site ← correct
D) IPR000169 — Cysteine peptidase, cysteine active site
[ANSWER]C[/ANSWER]
Build Reproducibility
This dataset is fully reproducible from the included build scripts and reference files:
scripts/
parse_interpro.py # Parses InterPro flat files into a queryable cache
build_mcq.py # Builds MCQ samples with 2-tier distractor fallback
reference/
entry.list # InterPro entries dump (downloaded 2026-04-09)
ParentChildTreeFile.txt # InterPro hierarchy tree (downloaded 2026-04-09)
label_pool.json # Union label pool across all 5 sub-tasks
To rebuild:
# 1. Refresh InterPro flat files (optional — pinned versions included)
curl -O https://ftp.ebi.ac.uk/pub/databases/interpro/current_release/entry.list
curl -O https://ftp.ebi.ac.uk/pub/databases/interpro/current_release/ParentChildTreeFile.txt
# 2. Parse into cache
python scripts/parse_interpro.py
# 3. Build MCQ (loads original VenusX Fragment datasets from AI4Protein/*)
python scripts/build_mcq.py
Known Limitations
Distractors are automatically generated, not peer-reviewed. Unlike MMLU or MedMCQA whose distractors are human-written by exam boards, our distractors come from random sampling / hierarchy traversal. Some may be too easy (e.g. a completely unrelated domain for a specific active site), inflating accuracy.
InterPro hierarchy coverage is low for
Active_site,Binding_site,Conserved_site, andRepeatentry types — EBI does not arrange these into hierarchies. As a result, Tier 1 (sibling-based) distractors only apply to a minority of samples (seedistractor_sourcecolumn for each sample's strategy).Random baseline is 25% (not 1/N of the original label space). Accuracy numbers from this MCQ benchmark should be interpreted against this 25% baseline, not the paper's full-label-space accuracy.
interpro_labelfield is preserved for traceability but not used in MCQ scoring. MCQ scoring comparespred_lettertocorrect_letter.Not comparable to VenusX paper Table 4 numbers. The paper reports ESM2 probe accuracy on the full label space; we report LLM accuracy on a 4-way MCQ. Same metric name (ACC), different semantics.
Citation
If you use this MCQ-reformulated dataset, please cite both the original VenusX paper and this fork:
@inproceedings{venusx2026,
title={VenusX: Unlocking Fine-Grained Functional Understanding of Proteins},
author={Tan, Yang and others},
booktitle={ICLR},
year={2026},
url={https://arxiv.org/abs/2505.11812}
}
References
The MCQ reformulation methodology draws from the following literature:
- Hendrycks et al., Measuring Massive Multitask Language Understanding (MMLU), ICLR 2021
- Pal et al., MedMCQA: A Large-scale Multi-Subject Multi-Choice Dataset for Medical domain Question Answering, CHIL 2022. https://arxiv.org/abs/2203.14371
- El-Sanyoury et al., Automatic distractor generation in multiple-choice questions: a systematic literature review, PeerJ Computer Science 2024. https://pmc.ncbi.nlm.nih.gov/articles/PMC11623049/
- Susanti, Iida & Tokunaga, Automatic Generation of English Vocabulary Tests (WordNet-based distractor), CSEDU 2015
- Gene Ontology sibling negatives: Frontiers in Genetics 2020, BMC Bioinformatics 2009
License
Derived from VenusX (AI4Protein). InterPro data is licensed CC-BY-4.0 from EMBL-EBI. This fork is released under CC-BY-4.0.
Contact
Built by hauser7733 as part of the SiEval evaluation framework. Questions or issues: open an issue at the SiEval repo.
- Downloads last month
- 32