Spaces:
Running
Running
| import gradio as gr | |
| import pandas as pd | |
| import numpy as np | |
| import torch | |
| import torch.nn as nn | |
| import torch.nn.functional as F | |
| import xgboost as xgb | |
| from transformers import AutoTokenizer, AutoModel, AutoConfig, EsmModel, EsmTokenizer | |
| import plotly.graph_objects as go | |
| from pathlib import Path | |
| import json | |
| import time | |
| from typing import List, Dict, Any, Tuple, Optional | |
| import subprocess | |
| from collections import defaultdict | |
| from huggingface_hub import snapshot_download | |
| from pathlib import Path | |
| import os | |
| from inference import ( | |
| PeptiVersePredictor, | |
| read_best_manifest_csv, | |
| BestRow, | |
| ) | |
| try: | |
| from Bio.SeqUtils.ProtParam import ProteinAnalysis | |
| BIOPYTHON_AVAILABLE = True | |
| except ImportError: | |
| BIOPYTHON_AVAILABLE = False | |
| print("BioPython not available. Using fallback for pI/charge calculations.") | |
| def pick_assets_root() -> Path: | |
| # HF Spaces container uses /home/user; detect via SPACE_ID or existence | |
| spaces_root = Path("/home/user/assets") | |
| if os.environ.get("SPACE_ID") or spaces_root.parent.exists(): | |
| try: | |
| spaces_root.mkdir(parents=True, exist_ok=True) | |
| return spaces_root | |
| except Exception: | |
| pass # fall through to local options | |
| # Allow manual override | |
| env = os.environ.get("HF_ASSETS_DIR") | |
| if env: | |
| p = Path(env); p.mkdir(parents=True, exist_ok=True) | |
| return p | |
| # Local fallbacks | |
| for p in [Path.home() / "assets", Path.cwd() / "assets", Path("/tmp/assets")]: | |
| try: | |
| p.mkdir(parents=True, exist_ok=True) | |
| return p | |
| except Exception: | |
| continue | |
| raise RuntimeError("No writable assets directory found.") | |
| ASSETS = pick_assets_root() | |
| # Put all caches on the same writable disk | |
| for k, v in { | |
| "HF_HOME": str(ASSETS / "hf"), | |
| "HUGGINGFACE_HUB_CACHE": str(ASSETS / "hf" / "cache"), | |
| "TRANSFORMERS_CACHE": str(ASSETS / "transformers"), | |
| "HF_DATASETS_CACHE": str(ASSETS / "hf" / "datasets"), | |
| "XDG_CACHE_HOME": str(ASSETS / "xdg"), | |
| "TMPDIR": str(ASSETS / "tmp"), | |
| }.items(): | |
| os.environ.setdefault(k, v) | |
| Path(v).mkdir(parents=True, exist_ok=True) | |
| ASSETS_MODELS = ASSETS / "models"; ASSETS_MODELS.mkdir(parents=True, exist_ok=True) | |
| ASSETS_DATA = ASSETS / "training_data_cleaned"; ASSETS_DATA.mkdir(parents=True, exist_ok=True) | |
| MODEL_REPO = "ChatterjeeLab/PeptiVerse" # model repo | |
| DATASET_REPO = "ChatterjeeLab/PeptiVerse" # dataset repo | |
| BEST_TXT = Path("basic_models.txt") | |
| TRAINING_ROOT = ASSETS_MODELS / "training_classifiers" | |
| #TOKENIZER_DIR = ASSETS_MODELS / "tokenizer" | |
| # Banned models that should fall back to XGB | |
| BANNED_MODELS = {"svm", "enet", "svm_gpu", "enet_gpu"} | |
| # "lower is better" exceptions for classification labeling | |
| LOWER_BETTER = {"hemolysis", "toxicity"} | |
| def canon_model(parsed) -> Optional[str]: | |
| """Return the bare lowercase model name from a parsed (model, emb_tag) tuple or raw string.""" | |
| if parsed is None: | |
| return None | |
| if isinstance(parsed, tuple): | |
| return parsed[0].lower() if parsed[0] else None | |
| return str(parsed).lower() | |
| def get_required_patterns(manifest_path: Path) -> List[str]: | |
| """Build allow_patterns from the manifest so we only download what we need.""" | |
| from inference import read_best_manifest_csv, EMB_TAG_TO_FOLDER_SUFFIX | |
| manifest = read_best_manifest_csv(manifest_path) | |
| patterns = set() | |
| patterns.add("training_data_cleaned/**/*.csv") | |
| for prop_key, row in manifest.items(): | |
| disk_prop = "half_life" if prop_key == "halflife" else prop_key | |
| for parsed in [row.best_wt, row.best_smiles]: | |
| if parsed is None: | |
| continue | |
| model_name, emb_tag = parsed | |
| if prop_key == "binding_affinity": | |
| folder = model_name # e.g. "wt_wt_pooled", "chemberta_smiles_pooled" | |
| patterns.add(f"training_classifiers/binding_affinity/{folder}/best_model*") | |
| continue | |
| # infer emb_tag fallback | |
| if emb_tag is None: | |
| emb_tag = "wt" if parsed == row.best_wt else "smiles" | |
| suffix = EMB_TAG_TO_FOLDER_SUFFIX.get(emb_tag, emb_tag) | |
| # halflife special cases | |
| if prop_key == "halflife" and emb_tag == "wt": | |
| if model_name in {"transformer"}: | |
| for variant in ["transformer_wt_log", "transformer_wt"]: | |
| patterns.add(f"training_classifiers/{disk_prop}/{variant}/best_model*") | |
| continue | |
| if model_name in {"xgb", "xgb_reg"}: | |
| patterns.add(f"training_classifiers/{disk_prop}/xgb_wt_log/best_model*") | |
| continue | |
| patterns.add(f"training_classifiers/{disk_prop}/{model_name}_{suffix}/best_model*") | |
| patterns.add(f"training_classifiers/{disk_prop}/{model_name}/best_model*") | |
| return sorted(patterns) | |
| def fetch_models_and_data(): | |
| patterns = get_required_patterns(BEST_TXT) | |
| print(f"Downloading {len(patterns)} targeted pattern(s):") | |
| for p in patterns: | |
| print(f" {p}") | |
| snapshot_download( | |
| repo_id=MODEL_REPO, | |
| local_dir=str(ASSETS_MODELS), | |
| local_dir_use_symlinks=False, | |
| allow_patterns=patterns, | |
| ) | |
| """ | |
| def fetch_models_and_data(): | |
| snapshot_download( | |
| repo_id=MODEL_REPO, | |
| local_dir=str(ASSETS_MODELS), | |
| local_dir_use_symlinks=False, | |
| allow_patterns=[ | |
| # Model files | |
| "training_classifiers/**/best_model*.json", | |
| "training_classifiers/**/best_model*.pt", | |
| "training_classifiers/**/best_model*.joblib", | |
| # Tokenizer files | |
| "tokenizer/new_vocab.txt", | |
| "tokenizer/new_splits.txt", | |
| # Training data for distributions | |
| "training_data_cleaned/**/*.csv", | |
| ], | |
| ) | |
| """ | |
| fetch_models_and_data() | |
| # Property display names and descriptions | |
| PROPERTY_INFO = { | |
| 'solubility': { | |
| 'display': 'π§ Solubility', | |
| 'description': 'Aqueous solubility', | |
| 'direction': 'β', | |
| 'pass_label': 'Soluble', | |
| 'fail_label': 'Insoluble' | |
| }, | |
| 'permeability_penetrance': { | |
| 'display': 'π¬ Permeability (Penetrance)', | |
| 'description': 'Cell penetration capability', | |
| 'direction': 'β', | |
| 'pass_label': 'Permeable', | |
| 'fail_label': 'Non-permeable' | |
| }, | |
| 'hemolysis': { | |
| 'display': 'π©Έ Hemolysis', | |
| 'description': 'Red blood cell membrane disruption', | |
| 'direction': 'β', | |
| 'pass_label': 'Non-hemolytic', | |
| 'fail_label': 'Hemolytic' | |
| }, | |
| 'nf': { | |
| 'display': 'π― Non-Fouling', | |
| 'description': 'Resistance to protein adsorption', | |
| 'direction': 'β', | |
| 'pass_label': 'Non-fouling', | |
| 'fail_label': 'Fouling' | |
| }, | |
| 'halflife': { | |
| 'display': 'β±οΈ Half-Life', | |
| 'description': 'Serum stability', | |
| 'direction': 'β', | |
| 'unit': 'hours' | |
| }, | |
| 'toxicity': { | |
| 'display': 'β οΈ Toxicity', | |
| 'description': 'Cytotoxicity', | |
| 'direction': 'β', | |
| 'pass_label': 'Non-toxic', | |
| 'fail_label': 'Toxic' | |
| }, | |
| 'permeability_pampa': { | |
| 'display': 'πͺ£ Permeability (PAMPA)', | |
| 'description': 'PAMPA assay permeability', | |
| 'direction': '', | |
| 'threshold': -6, # Values > -6 are permeable | |
| 'pass_label': 'Permeable', | |
| 'fail_label': 'Non-permeable' | |
| }, | |
| 'permeability_caco2': { | |
| 'display': 'πͺ£ Permeability (Caco-2)', | |
| 'description': 'Caco-2 cell permeability', | |
| 'direction': '', | |
| 'threshold': -6, # Values > -6 are permeable | |
| 'pass_label': 'Permeable', | |
| 'fail_label': 'Non-permeable' | |
| }, | |
| 'binding_affinity': { | |
| 'display': 'π Binding Affinity', | |
| 'description': 'Protein-peptide binding strength', | |
| 'direction': 'β', | |
| 'thresholds': {'tight': 9, 'weak': 7} | |
| } | |
| } | |
| PROP_ORDER = [ | |
| 'solubility', | |
| 'permeability_penetrance', | |
| 'hemolysis', | |
| 'nf', | |
| 'halflife', | |
| 'toxicity', | |
| 'permeability_pampa', | |
| 'permeability_caco2', | |
| 'binding_affinity', | |
| ] | |
| # Distribution-only keys | |
| DIST_KEYS = { | |
| "binding_affinity_wt": "π Binding Affinity β WT (distribution)", | |
| "binding_affinity_smiles": "π Binding Affinity β SMILES (distribution)", | |
| "binding_affinity_all": "π Binding Affinity β WT+SMILES (distribution)", | |
| "halflife_wt": "β±οΈ Half-life β WT (distribution)", | |
| "halflife_smiles": "β±οΈ Half-life β SMILES (distribution)", | |
| "halflife_all": "β±οΈ Half-life β WT+SMILES (distribution)", | |
| } | |
| def create_filtered_manifest(manifest_path: Path) -> Dict[str, BestRow]: | |
| """Read manifest and replace banned models with XGB""" | |
| original = read_best_manifest_csv(manifest_path) | |
| filtered = {} | |
| for prop_key, row in original.items(): | |
| # Normalize property key for half-life | |
| normalized_key = prop_key | |
| if prop_key in ['halflife', 'half_life']: | |
| normalized_key = 'halflife' | |
| # Check and potentially replace WT model | |
| wt_model = canon_model(row.best_wt) | |
| if wt_model in BANNED_MODELS: | |
| wt_model = "XGB" | |
| elif wt_model is None: | |
| wt_model = row.best_wt | |
| else: | |
| wt_model = row.best_wt | |
| # Check and potentially replace SMILES model | |
| smiles_model = canon_model(row.best_smiles) | |
| if smiles_model in BANNED_MODELS: | |
| smiles_model = "XGB" | |
| elif smiles_model is None: | |
| smiles_model = row.best_smiles | |
| else: | |
| smiles_model = row.best_smiles | |
| # Create modified row | |
| filtered[normalized_key] = BestRow( | |
| property_key=normalized_key, | |
| best_wt=wt_model if wt_model != row.best_wt else row.best_wt, | |
| best_smiles=smiles_model if smiles_model != row.best_smiles else row.best_smiles, | |
| task_type=row.task_type, | |
| thr_wt=row.thr_wt, | |
| thr_smiles=row.thr_smiles, | |
| ) | |
| return filtered | |
| class AppContext: | |
| def __init__(self): | |
| self.device = torch.device("cuda" if torch.cuda.is_available() else "cpu") | |
| self.best = create_filtered_manifest(BEST_TXT) | |
| self.predictor = PeptiVersePredictor( | |
| manifest_path=BEST_TXT, | |
| classifier_weight_root=ASSETS_MODELS, | |
| esm_name="facebook/esm2_t33_650M_UR50D", | |
| clm_name="aaronfeller/PeptideCLM-23M-all", | |
| smiles_vocab=str(Path(__file__).parent / "tokenizer" / "new_vocab.txt"), | |
| smiles_splits=str(Path(__file__).parent / "tokenizer" / "new_splits.txt"), | |
| device=str(self.device), | |
| ) | |
| # override manifest AND reload models so keys/folders match | |
| self.predictor.manifest = self.best | |
| self.predictor.models.clear() | |
| self.predictor.meta.clear() | |
| self.predictor._load_all_best_models() | |
| CTX: AppContext | None = None | |
| def initialize(): | |
| global CTX | |
| if CTX is None: | |
| CTX = AppContext() | |
| return CTX | |
| def get_available_properties(ctx, modality: str) -> Dict[str, bool]: | |
| """ | |
| Returns dict of property -> bool indicating if available for the modality | |
| """ | |
| available = {} | |
| for prop_key in PROPERTY_INFO.keys(): | |
| if prop_key not in ctx.best: | |
| available[prop_key] = False | |
| continue | |
| row = ctx.best[prop_key] | |
| if modality == "Sequence": | |
| model = row.best_wt | |
| else: | |
| model = row.best_smiles | |
| # Check if model exists and is not empty/dash | |
| if not model or model in {"-", "β", "NA", "N/A", None}: | |
| available[prop_key] = False | |
| else: | |
| # Check if we actually have the model loaded | |
| mode = "wt" if modality == "Sequence" else "smiles" | |
| available[prop_key] = (prop_key, mode) in ctx.predictor.models | |
| return available | |
| def get_threshold(ctx: AppContext, prop: str, modality: str) -> float | None: | |
| row = ctx.best.get(prop) | |
| if row is None: | |
| return None | |
| return row.thr_wt if modality == "Sequence" else row.thr_smiles | |
| def get_best_models_table(ctx: AppContext) -> pd.DataFrame: | |
| """Generate a table showing best models and thresholds""" | |
| data = [] | |
| for prop_key, row in ctx.best.items(): | |
| prop_info = PROPERTY_INFO.get(prop_key, {}) | |
| display_name = prop_info.get('display', prop_key) | |
| data.append({ | |
| 'Property': display_name, | |
| 'Best Model (Sequence)': row.best_wt if row.best_wt else 'β', | |
| 'Threshold (Sequence)': f"{row.thr_wt:.4f}" if row.thr_wt is not None else 'β', | |
| 'Best Model (SMILES)': row.best_smiles if row.best_smiles else 'β', | |
| 'Threshold (SMILES)': f"{row.thr_smiles:.4f}" if row.thr_smiles is not None else 'β', | |
| 'Task Type': row.task_type | |
| }) | |
| return pd.DataFrame(data) | |
| try: | |
| from rdkit import Chem | |
| from rdkit.Chem import Descriptors, AllChem | |
| RDKIT_AVAILABLE = True | |
| except ImportError: | |
| RDKIT_AVAILABLE = False | |
| print("RDKit not available. SMILES input will be disabled.") | |
| import re | |
| AA_RE = re.compile(r'^[ACDEFGHIKLMNPQRSTVWYBXZJUO\-]+$', re.IGNORECASE) | |
| def is_aa_sequence_like(s: str) -> bool: | |
| s = s.strip().replace(" ", "") | |
| if not s: | |
| return False | |
| # Very lenient: allow AA letters + optional '-' for readability | |
| return bool(AA_RE.fullmatch(s)) and any(c.isalpha() for c in s) | |
| def is_smiles_like(s: str) -> bool: | |
| s = s.strip() | |
| if not s: | |
| return False | |
| # Heuristic: SMILES often contains these symbols; also reject if it looks like pure AA | |
| maybe_smiles_chars = set("=#()[]+\\/-@1234567890") | |
| return (any(ch in maybe_smiles_chars for ch in s) or not is_aa_sequence_like(s)) and len(s) >= 2 | |
| # ==================== Sequence Analysis ==================== | |
| class SequenceAnalyzer: | |
| """Calculate physicochemical properties of peptide sequences | |
| If biopython fail. | |
| """ | |
| # pKa values for amino acids | |
| PKA_VALUES = { | |
| 'N_term': 9.6, | |
| 'C_term': 2.3, | |
| 'D': 3.9, # Aspartic acid | |
| 'E': 4.2, # Glutamic acid | |
| 'H': 6.0, # Histidine | |
| 'C': 8.3, # Cysteine | |
| 'Y': 10.1, # Tyrosine | |
| 'K': 10.5, # Lysine | |
| 'R': 12.5, # Arginine | |
| } | |
| def calculate_net_charge(cls, sequence: str, pH: float = 7.0) -> float: | |
| """Calculate net charge at given pH using Henderson-Hasselbalch equation""" | |
| if BIOPYTHON_AVAILABLE: | |
| try: | |
| analyzer = ProteinAnalysis(sequence) | |
| return analyzer.charge_at_pH(pH) | |
| except: | |
| pass | |
| # Fallback calculation | |
| charge = 0 | |
| # N-terminus | |
| charge += 1 / (1 + 10**(pH - cls.PKA_VALUES['N_term'])) | |
| # C-terminus | |
| charge -= 1 / (1 + 10**(cls.PKA_VALUES['C_term'] - pH)) | |
| # Count charged residues | |
| for aa in sequence: | |
| if aa in 'KR': # Positive | |
| pKa = cls.PKA_VALUES.get(aa, cls.PKA_VALUES['K' if aa == 'K' else 'R']) | |
| charge += 1 / (1 + 10**(pH - pKa)) | |
| elif aa in 'DE': # Negative | |
| pKa = cls.PKA_VALUES.get(aa, cls.PKA_VALUES['D' if aa == 'D' else 'E']) | |
| charge -= 1 / (1 + 10**(pKa - pH)) | |
| elif aa == 'H': # Histidine (positive when protonated) | |
| charge += 1 / (1 + 10**(pH - cls.PKA_VALUES['H'])) | |
| elif aa == 'C': # Cysteine (negative when deprotonated) | |
| charge -= 1 / (1 + 10**(cls.PKA_VALUES['C'] - pH)) | |
| elif aa == 'Y': # Tyrosine (negative when deprotonated) | |
| charge -= 1 / (1 + 10**(cls.PKA_VALUES['Y'] - pH)) | |
| return round(charge, 2) | |
| def calculate_isoelectric_point(cls, sequence: str) -> float: | |
| """Calculate theoretical pI using bisection method""" | |
| if BIOPYTHON_AVAILABLE: | |
| try: | |
| analyzer = ProteinAnalysis(sequence) | |
| return analyzer.isoelectric_point() | |
| except: | |
| pass | |
| # Fallback: Bisection method | |
| pH_min, pH_max = 0.0, 14.0 | |
| epsilon = 0.01 | |
| while (pH_max - pH_min) > epsilon: | |
| pH_mid = (pH_min + pH_max) / 2 | |
| charge = cls.calculate_net_charge(sequence, pH_mid) | |
| if abs(charge) < epsilon: | |
| return round(pH_mid, 2) | |
| if charge > 0: | |
| pH_min = pH_mid | |
| else: | |
| pH_max = pH_mid | |
| return round((pH_min + pH_max) / 2, 2) | |
| def calculate_molecular_weight(cls, sequence: str) -> float: | |
| """Calculate molecular weight""" | |
| if BIOPYTHON_AVAILABLE: | |
| try: | |
| analyzer = ProteinAnalysis(sequence) | |
| return analyzer.molecular_weight() | |
| except: | |
| pass | |
| # Fallback: approximate calculation | |
| weights = { | |
| 'A': 89.1, 'C': 121.2, 'D': 133.1, 'E': 147.1, 'F': 165.2, | |
| 'G': 75.1, 'H': 155.2, 'I': 131.2, 'K': 146.2, 'L': 131.2, | |
| 'M': 149.2, 'N': 132.1, 'P': 115.1, 'Q': 146.2, 'R': 174.2, | |
| 'S': 105.1, 'T': 119.1, 'V': 117.1, 'W': 204.2, 'Y': 181.2 | |
| } | |
| mw = sum(weights.get(aa, 0) for aa in sequence) | |
| # Subtract water for peptide bonds | |
| mw -= 18.0 * (len(sequence) - 1) | |
| return round(mw, 1) | |
| def calculate_hydrophobicity(cls, sequence: str) -> float: | |
| """Calculate GRAVY (grand average of hydropathy)""" | |
| if BIOPYTHON_AVAILABLE: | |
| try: | |
| analyzer = ProteinAnalysis(sequence) | |
| return analyzer.gravy() | |
| except: | |
| pass | |
| # Kyte-Doolittle scale | |
| hydrophobicity = { | |
| 'A': 1.8, 'C': 2.5, 'D': -3.5, 'E': -3.5, 'F': 2.8, | |
| 'G': -0.4, 'H': -3.2, 'I': 4.5, 'K': -3.9, 'L': 3.8, | |
| 'M': 1.9, 'N': -3.5, 'P': -1.6, 'Q': -3.5, 'R': -4.5, | |
| 'S': -0.8, 'T': -0.7, 'V': 4.2, 'W': -0.9, 'Y': -1.3 | |
| } | |
| if len(sequence) == 0: | |
| return 0 | |
| total = sum(hydrophobicity.get(aa, 0) for aa in sequence) | |
| return round(total / len(sequence), 2) | |
| # ==================== Data Management ==================== | |
| class TrainingDataManager: | |
| def __init__(self, data_dir=None): | |
| possible_dirs = [ | |
| ASSETS_MODELS / "training_data_cleaned", # In HF downloaded location | |
| Path("training_data_cleaned"), # Local relative path | |
| ASSETS_DATA, # Original location | |
| ] | |
| self.data_dir = None | |
| for d in possible_dirs: | |
| if d.exists(): | |
| self.data_dir = d | |
| print(f"Using data directory: {d}") | |
| break | |
| if self.data_dir is None: | |
| print(f"WARNING: No data directory found. Tried: {possible_dirs}") | |
| self.data_dir = ASSETS_DATA # Fallback | |
| self.data_dir.mkdir(exist_ok=True) | |
| self.statistics = self.load_statistics() | |
| def load_csv_data(self, filepath: Path, value_column, is_binary: bool = False) -> Optional[Dict]: | |
| """Load data from a CSV file. | |
| value_column can be a string OR a list/tuple of candidate column names. | |
| """ | |
| if not filepath.exists(): | |
| print(f"File not found: {filepath}") | |
| return None | |
| try: | |
| df = pd.read_csv(filepath, encoding="utf-8", on_bad_lines="skip") | |
| print(f"Columns in {filepath.name}: {df.columns.tolist()[:5]}...") | |
| # Case-insensitive column map | |
| col_lower = {col.lower(): col for col in df.columns} | |
| # allow list/tuple of candidates | |
| if isinstance(value_column, (list, tuple)): | |
| chosen = None | |
| for c in value_column: | |
| if c is None: | |
| continue | |
| c_l = str(c).lower() | |
| if c_l in col_lower: | |
| chosen = col_lower[c_l] | |
| break | |
| if chosen is None: | |
| print(f"None of candidate columns {value_column} found. Available: {list(df.columns)[:10]}") | |
| return None | |
| value_column = chosen | |
| else: | |
| # keep original behavior, but safe-cast to str | |
| vc_l = str(value_column).lower() | |
| if vc_l not in col_lower: | |
| alternatives = { | |
| 'label': ['label', 'labels', 'y', 'target'], | |
| 'affinity': ['affinity', 'pkd', 'pki', 'binding_affinity'], | |
| 'pampa': ['pampa', 'pampa_value', 'permeability'], | |
| 'caco2': ['caco2', 'caco-2', 'caco_2'], | |
| 'log_hour': ['log_hour', 'loghour', 'log_hours', 'loghours'], | |
| 'half_life_hours': ['half_life_hours', 'halflife_hours', 'hours'], | |
| 'half_life_seconds': ['half_life_seconds', 'halflife_seconds', 'seconds'], | |
| } | |
| found = False | |
| for alt in alternatives.get(vc_l, []): | |
| if alt.lower() in col_lower: | |
| value_column = col_lower[alt.lower()] | |
| found = True | |
| break | |
| if not found: | |
| print(f"Column {value_column} not found. Available: {list(df.columns)[:10]}") | |
| return None | |
| else: | |
| value_column = col_lower[vc_l] | |
| vals = pd.to_numeric(df[value_column], errors="coerce").dropna().to_numpy() | |
| if len(vals) == 0: | |
| print(f"No valid values found in column {value_column}") | |
| return None | |
| print(f"Loaded {len(vals)} values from {filepath.name}") | |
| if is_binary: | |
| unique_vals = np.unique(vals) | |
| if not set(unique_vals).issubset({0, 1, 0.0, 1.0}): | |
| vals = (vals > 0.5).astype(int) | |
| return {"values": vals, "n_samples": len(vals)} | |
| except Exception as e: | |
| print(f"Error loading {filepath}: {e}") | |
| import traceback | |
| traceback.print_exc() | |
| return None | |
| def load_statistics(self): | |
| """Load pre-computed statistics for each property from actual data files""" | |
| stats = {} | |
| # Map properties to their data files and value columns | |
| data_mappings = { | |
| 'hemolysis': { | |
| 'files': [ | |
| 'hemolysis/hemo_meta_with_split.csv', | |
| 'hemolysis/hemolysis_meta_with_split.csv', | |
| ], | |
| 'column': 'label', | |
| 'is_binary': True | |
| }, | |
| 'solubility': { | |
| 'files': [ | |
| 'solubility/sol_meta_with_split.csv', | |
| 'solubility/solubility_meta_with_split.csv', | |
| ], | |
| 'column': 'label', | |
| 'is_binary': True | |
| }, | |
| "binding_affinity_wt": { | |
| "files": ["binding_affinity/binding_affinity_wt_meta_with_split.csv"], | |
| "column": "affinity", | |
| "is_binary": False | |
| }, | |
| "binding_affinity_smiles": { | |
| "files": ["binding_affinity/binding_affinity_smiles_meta_with_split.csv"], | |
| "column": "affinity", | |
| "is_binary": False | |
| }, | |
| "binding_affinity_all": { | |
| "files": [ | |
| "binding_affinity/binding_affinity_wt_meta_with_split.csv", | |
| "binding_affinity/binding_affinity_smiles_meta_with_split.csv", | |
| ], | |
| "column": "affinity", | |
| "is_binary": False | |
| }, | |
| "halflife_wt": { | |
| "files": [ | |
| "half_life/halflife_with_split.csv", | |
| "half_life/halflife_meta_with_split.csv", | |
| ], | |
| "column": ["half_life_hours", "log_hour", "log_hours"], | |
| "is_binary": False | |
| }, | |
| "halflife_smiles": { | |
| "files": [ | |
| "half_life/halflife_smiles_with_split.csv", | |
| "half_life/halflife_smiles_with_splits.csv", | |
| "half_life/halflife_smiles_meta_with_split.csv", | |
| ], | |
| "column": ["half_life_hours", "log_hour", "log_hours"], | |
| "is_binary": False | |
| }, | |
| "halflife_all": { | |
| "files": [ | |
| "half_life/halflife_with_split.csv", | |
| "half_life/halflife_meta_with_split.csv", | |
| "half_life/halflife_smiles_with_split.csv", | |
| "half_life/halflife_smiles_with_splits.csv", | |
| "half_life/halflife_smiles_meta_with_split.csv", | |
| ], | |
| "column": ["half_life_hours", "log_hour", "log_hours"], | |
| "is_binary": False | |
| }, | |
| 'nf': { | |
| 'files': [ | |
| 'nonfouling/nf_meta_with_split.csv', | |
| 'nf/nf_meta_with_split.csv', | |
| ], | |
| 'column': 'label', | |
| 'is_binary': True | |
| }, | |
| 'permeability_penetrance': { | |
| 'files': [ | |
| 'permeability/perm_meta_with_split.csv', | |
| 'permeability_penetrance/permeability_meta_with_split.csv', | |
| ], | |
| 'column': 'label', | |
| 'is_binary': True | |
| }, | |
| 'permeability_pampa': { | |
| 'files': [ | |
| 'permeability_pampa/pampa_meta_with_split.csv', | |
| 'pampa/pampa_meta_with_split.csv', | |
| ], | |
| 'column': 'PAMPA', | |
| 'is_binary': False | |
| }, | |
| 'permeability_caco2': { | |
| 'files': [ | |
| 'permeability_caco2/caco2_meta_with_split.csv', | |
| 'caco2/caco2_meta_with_split.csv', | |
| ], | |
| 'column': 'Caco2', | |
| 'is_binary': False | |
| }, | |
| 'toxicity': { | |
| 'files': [ | |
| 'toxicity/tox_meta_with_split.csv', | |
| 'toxicity/toxicity_meta_with_split.csv', | |
| ], | |
| 'column': 'label', | |
| 'is_binary': True | |
| } | |
| } | |
| # Load actual data | |
| for prop_key, mapping in data_mappings.items(): | |
| all_vals = [] | |
| loaded_from = [] | |
| for file_path in mapping['files']: | |
| filepath = self.data_dir / file_path | |
| if not filepath.exists(): | |
| continue | |
| d = self.load_csv_data( | |
| filepath, | |
| mapping['column'], | |
| mapping.get('is_binary', False) | |
| ) | |
| if d: | |
| all_vals.append(d["values"]) | |
| loaded_from.append(file_path) | |
| if all_vals: | |
| vals = np.concatenate(all_vals, axis=0) | |
| prop_info = PROPERTY_INFO.get(prop_key, {}) | |
| stats[prop_key] = { | |
| "values": vals, | |
| "description": prop_info.get("description", ""), | |
| "unit": "Probability" if mapping.get("is_binary") else prop_info.get("unit", "Score"), | |
| "n_samples": int(vals.shape[0]), | |
| "kind": "binary" if mapping.get("is_binary") else "continuous", | |
| "loaded_from": loaded_from, # optional: good for debugging | |
| } | |
| # thresholds / unit tweaks | |
| if prop_key == "binding_affinity": | |
| stats[prop_key]["threshold"] = 9 | |
| stats[prop_key]["threshold_secondary"] = 7 | |
| stats[prop_key]["unit"] = "pKd/pKi" | |
| elif prop_key in ["permeability_pampa", "permeability_caco2"]: | |
| stats[prop_key]["threshold"] = -6 | |
| stats[prop_key]["unit"] = "log Peff" if prop_key == "permeability_pampa" else "log Papp" | |
| elif prop_key == "halflife": | |
| stats[prop_key]["unit"] = "hours" | |
| # for distribution plotting | |
| if prop_key.startswith("binding_affinity"): | |
| stats[prop_key]["threshold"] = 9 | |
| stats[prop_key]["threshold_secondary"] = 7 | |
| stats[prop_key]["unit"] = "pKd/pKi" | |
| elif prop_key.startswith("halflife"): | |
| stats[prop_key]["unit"] = "hours" | |
| print(f"β Loaded {prop_key} from {loaded_from} ({len(vals)} samples)") | |
| continue | |
| # fallback synthetic | |
| print(f"β Using synthetic data for {prop_key}") | |
| return stats | |
| def get_distribution_plot(self, property_name, current_value=None): | |
| if property_name not in self.statistics: | |
| return None | |
| s = self.statistics[property_name] | |
| vals = np.asarray(s["values"]) | |
| kind = s.get("kind", "continuous") | |
| if kind == "binary": | |
| n0 = int((vals == 0).sum()) | |
| n1 = int((vals == 1).sum()) | |
| total = max(n0 + n1, 1) | |
| fig = go.Figure() | |
| prop_info = PROPERTY_INFO.get(property_name, {}) | |
| labels = [ | |
| prop_info.get('fail_label', 'Negative (0)'), | |
| prop_info.get('pass_label', 'Positive (1)') | |
| ] | |
| fig.add_trace(go.Bar(x=labels, y=[n0, n1])) | |
| fig.update_layout( | |
| title=f"{prop_info.get('display', property_name)} β Class Distribution", | |
| xaxis_title="Class", | |
| yaxis_title="Count", | |
| height=400, | |
| showlegend=False, | |
| annotations=[ | |
| dict(x=labels[0], y=n0, text=f"{n0} ({n0/total:.1%})", showarrow=False, yshift=8), | |
| dict(x=labels[1], y=n1, text=f"{n1} ({n1/total:.1%})", showarrow=False, yshift=8), | |
| ], | |
| ) | |
| return fig | |
| # Continuous distribution | |
| fig = go.Figure() | |
| fig.add_trace(go.Histogram(x=vals, nbinsx=50, name="Training Data")) | |
| # Primary threshold (if any) | |
| if "threshold" in s and s["threshold"] is not None: | |
| fig.add_vline( | |
| x=float(s["threshold"]), | |
| line_dash="dash", | |
| line_color="purple" if property_name == "binding_affinity" else "red", | |
| annotation_text=( | |
| "Tight threshold: {:.3f}".format(float(s["threshold"])) | |
| if property_name == "binding_affinity" | |
| else "Threshold: {:.3f}".format(float(s["threshold"])) | |
| ), | |
| ) | |
| # Secondary threshold for binding (weak) | |
| if property_name == "binding_affinity" and "threshold_secondary" in s and s["threshold_secondary"] is not None: | |
| fig.add_vline( | |
| x=float(s["threshold_secondary"]), | |
| line_dash="dash", | |
| line_color="orange", | |
| annotation_text="Weak threshold: {:.3f}".format(float(s["threshold_secondary"])), | |
| ) | |
| # Current value | |
| if current_value is not None: | |
| fig.add_vline( | |
| x=float(current_value), | |
| line_dash="solid", | |
| line_color="green", | |
| line_width=3, | |
| annotation_text=f"Your Result: {float(current_value):.3f}", | |
| ) | |
| prop_info = PROPERTY_INFO.get(property_name, {}) | |
| fig.update_layout( | |
| title=f"{prop_info.get('display', property_name)} Distribution", | |
| xaxis_title=s.get("unit", ""), | |
| yaxis_title="Count", | |
| height=400, | |
| showlegend=False, | |
| ) | |
| return fig | |
| def get_property_info(self, property_name): | |
| if property_name not in self.statistics: | |
| return None | |
| s = self.statistics[property_name] | |
| vals = np.asarray(s["values"]) | |
| kind = s.get("kind", "continuous") | |
| info = { | |
| "description": s.get("description", ""), | |
| "unit": s.get("unit", ""), | |
| "n_samples": int(len(vals)), | |
| "mean": float(np.mean(vals)), | |
| "std": float(np.std(vals)), | |
| "min": float(np.min(vals)), | |
| "max": float(np.max(vals)), | |
| "percentiles": {}, | |
| } | |
| if kind == "binary": | |
| info["n_neg"] = int((vals == 0).sum()) | |
| info["n_pos"] = int((vals == 1).sum()) | |
| else: | |
| pct = np.percentile(vals, [10, 25, 50, 75, 90]) | |
| info["percentiles"] = { | |
| "10%": float(pct[0]), | |
| "25%": float(pct[1]), | |
| "50% (median)": float(pct[2]), | |
| "75%": float(pct[3]), | |
| "90%": float(pct[4]), | |
| } | |
| return info | |
| # ==================== Gradio Interface ==================== | |
| def predict_properties( | |
| input_text: str, | |
| input_type: str, # "Sequence" or "SMILES" | |
| protein_text: str, # For binding affinity | |
| selected_props: list[str], # from individual checkboxes | |
| include_physicochemical: bool, | |
| pH_value: float, | |
| progress=gr.Progress() | |
| ): | |
| if not input_text or not input_text.strip(): | |
| return None, "β οΈ Please provide input." | |
| lines = [s.strip() for s in input_text.split("\n") if s.strip()] | |
| if input_type == "Sequence": | |
| bad = [s for s in lines if not is_aa_sequence_like(s)] | |
| if bad: | |
| return None, f"β οΈ Input Type=Sequence but {len(bad)} line(s) don't look like AA sequences. Example: {bad[0][:60]}" | |
| else: | |
| bad = [s for s in lines if not is_smiles_like(s)] | |
| if bad: | |
| return None, f"β οΈ Input Type=SMILES but {len(bad)} line(s) don't look like SMILES. Example: {bad[0][:60]}" | |
| ctx = initialize() | |
| print("keys in ctx.best:", sorted(ctx.best.keys())) | |
| print("loaded model keys:", sorted(ctx.predictor.models.keys())) | |
| print("halflife wt loaded?", ("halflife","wt") in ctx.predictor.models) | |
| print("halflife smiles loaded?", ("halflife","smiles") in ctx.predictor.models) | |
| if not selected_props: | |
| return None, "β οΈ Please select at least one property." | |
| results = [] | |
| analyzer = SequenceAnalyzer() | |
| # Check availability | |
| available = get_available_properties(ctx, input_type) | |
| unavailable = [p for p in selected_props if not available.get(p, False)] | |
| if unavailable: | |
| unavailable_names = [PROPERTY_INFO.get(p, {}).get('display', p) for p in unavailable] | |
| return None, f"β οΈ These properties are not supported for {input_type}: {', '.join(unavailable_names)}" | |
| for i, s in enumerate(lines): | |
| progress((i + 1) / len(lines), f"Processing {i+1}/{len(lines)}") | |
| # Regular property predictions | |
| for prop in selected_props: | |
| if prop == "binding_affinity": | |
| # Handle binding affinity separately | |
| if not protein_text or not protein_text.strip(): | |
| results.append({ | |
| "Input": s[:30] + "..." if len(s) > 30 else s, | |
| "Property": PROPERTY_INFO[prop]['display'], | |
| "Prediction": "N/A", | |
| "Value": "Requires protein", | |
| "Unit": "", | |
| }) | |
| continue | |
| mode = "wt" if input_type == "Sequence" else "smiles" | |
| try: | |
| result = ctx.predictor.predict_binding_affinity(mode, protein_text.strip(), s) | |
| affinity = result["affinity"] | |
| # Determine binding class based on thresholds | |
| if affinity >= 9: | |
| class_label = "Tight binding" | |
| elif affinity >= 7: | |
| class_label = "Medium binding" | |
| else: | |
| class_label = "Weak binding" | |
| results.append({ | |
| "Input": s[:30] + "..." if len(s) > 30 else s, | |
| "Property": PROPERTY_INFO[prop]['display'], | |
| "Prediction": class_label, | |
| "Value": f"{affinity:.3f}", | |
| "Unit": "pKd/pKi", | |
| }) | |
| except Exception as e: | |
| print(f"Error predicting binding affinity: {e}") | |
| results.append({ | |
| "Input": s[:30] + "..." if len(s) > 30 else s, | |
| "Property": PROPERTY_INFO[prop]['display'], | |
| "Prediction": "Error", | |
| "Value": "Failed", | |
| "Unit": "", | |
| }) | |
| continue | |
| # Regular properties | |
| mode = "wt" if input_type == "Sequence" else "smiles" | |
| try: | |
| result = ctx.predictor.predict_property(prop, mode, s) | |
| score = result["score"] | |
| prop_info = PROPERTY_INFO.get(prop, {}) | |
| # Determine label based on property type | |
| if prop in ['permeability_pampa', 'permeability_caco2']: | |
| # Special handling for permeability assays | |
| label = prop_info['pass_label'] if score > -6 else prop_info['fail_label'] | |
| unit = "log Peff" if prop == 'permeability_pampa' else "log Papp" | |
| elif prop == 'halflife': | |
| # Regression task, no pass/fail | |
| label = "β" | |
| unit = prop_info.get('unit', 'hours') | |
| else: | |
| # Classification tasks | |
| thr = get_threshold(ctx, prop, input_type) | |
| if thr is not None: | |
| if prop in LOWER_BETTER: | |
| label = prop_info.get('pass_label', 'Pass') if score < thr else prop_info.get('fail_label', 'Fail') | |
| else: | |
| label = prop_info.get('pass_label', 'Pass') if score >= thr else prop_info.get('fail_label', 'Fail') | |
| else: | |
| label = "β" | |
| unit = "Probability" | |
| results.append({ | |
| "Input": s[:30] + "..." if len(s) > 30 else s, | |
| "Property": prop_info.get('display', prop), | |
| "Prediction": label, | |
| "Value": f"{score:.3f}", | |
| "Unit": unit, | |
| }) | |
| except Exception as e: | |
| print(f"Error predicting {prop} for {s[:30]}: {e}") | |
| continue | |
| # physicochemical only for AA sequence modality | |
| if input_type == "Sequence" and include_physicochemical: | |
| analysis = { | |
| "length": len(s), | |
| "molecular_weight": analyzer.calculate_molecular_weight(s), | |
| "net_charge": analyzer.calculate_net_charge(s, pH_value), | |
| "isoelectric_point": analyzer.calculate_isoelectric_point(s), | |
| "hydrophobicity": analyzer.calculate_hydrophobicity(s), | |
| } | |
| short = s[:30] + "..." if len(s) > 30 else s | |
| results += [ | |
| {"Input": short, "Property": "π Length", "Prediction": "", "Value": str(analysis["length"]), "Unit": "aa"}, | |
| {"Input": short, "Property": "βοΈ Molecular Weight", "Prediction": "", "Value": f"{analysis['molecular_weight']:.1f}", "Unit": "Da"}, | |
| {"Input": short, "Property": f"β‘ Net Charge (pH {pH_value})", "Prediction": "", "Value": f"{analysis['net_charge']:.2f}", "Unit": ""}, | |
| {"Input": short, "Property": "π― Isoelectric Point", "Prediction": "", "Value": f"{analysis['isoelectric_point']:.2f}", "Unit": "pH"}, | |
| {"Input": short, "Property": "π¦ Hydrophobicity (GRAVY)", "Prediction": "", "Value": f"{analysis['hydrophobicity']:.2f}", "Unit": "GRAVY"}, | |
| ] | |
| df = pd.DataFrame(results) | |
| status = f"β Completed {len(df)} rows ({len(lines)} input(s), {len(selected_props)} selected properties)." | |
| return df, status | |
| def show_distribution(property_name, predicted_value=None): | |
| """Show distribution plot + info for selected property.""" | |
| data_manager = TrainingDataManager() | |
| if not property_name: | |
| return None, "Select a property to view its distribution." | |
| # Get the first property if a list was passed | |
| prop = property_name[0] if isinstance(property_name, list) else property_name | |
| # Generate the plot | |
| fig = data_manager.get_distribution_plot(prop, predicted_value) | |
| # Build info panel | |
| info = data_manager.get_property_info(prop) | |
| if not info: | |
| return fig, "No information available for this property." | |
| prop_info = PROPERTY_INFO.get(prop, {}) | |
| title = DIST_KEYS.get(prop, PROPERTY_INFO.get(prop, {}).get("display", prop)) | |
| kind = data_manager.statistics.get(prop, {}).get("kind", "continuous") | |
| if kind == "binary": | |
| n_pos = info.get("n_pos", 0) | |
| n_neg = info.get("n_neg", 0) | |
| total = max(n_pos + n_neg, 1) | |
| info_text = f""" | |
| #### {title} Information | |
| **Description:** {info.get('description','')} | |
| **Statistics (Binary):** | |
| - Samples: {info['n_samples']:,} | |
| - {prop_info.get('pass_label', 'Positive')} (1): {n_pos:,} ({n_pos/total:.1%}) | |
| - {prop_info.get('fail_label', 'Negative')} (0): {n_neg:,} ({n_neg/total:.1%}) | |
| """ | |
| else: | |
| p = info.get("percentiles", {}) | |
| info_text = f""" | |
| #### {title} Information | |
| **Description:** {info.get('description','')} | |
| **Statistics:** | |
| - Samples: {info['n_samples']:,} | |
| - Mean: {info['mean']:.3f} {info['unit']} | |
| - Std Dev: {info['std']:.3f} | |
| - Range: [{info['min']:.3f}, {info['max']:.3f}] | |
| **Percentiles:** | |
| - 10%: {p.get('10%', float('nan')):.3f} | |
| - 25%: {p.get('25%', float('nan')):.3f} | |
| - 50% (median): {p.get('50% (median)', float('nan')):.3f} | |
| - 75%: {p.get('75%', float('nan')):.3f} | |
| - 90%: {p.get('90%', float('nan')):.3f} | |
| """ | |
| return fig, info_text | |
| def load_example(example_name): | |
| """Load example sequences""" | |
| examples = { | |
| "T7 Peptide": ("HAIYPRH", ""), | |
| "Protein-Peptide": ( | |
| "GIVEQCCTSICSLYQLENYCN", | |
| "MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLST" | |
| ), | |
| "Cyclic Peptide (SMILES)": ( | |
| "CC(C)C[C@@H]1NC(=O)[C@@H](CC(C)C)N(C)C(=O)[C@@H](C)N(C)C(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H]2CCCN2C1=O", | |
| "" | |
| ), | |
| "Protein-Cyclic Peptide (SMILES)": ( | |
| "CC(C)C[C@@H]1NC(=O)[C@@H](CC(C)C)N(C)C(=O)[C@@H](C)N(C)C(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H]2CCCN2C1=O", | |
| "MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLST" | |
| ), | |
| "None": ("", ""), | |
| } | |
| return examples.get(example_name, ("", "")) | |
| def on_example_change(name: str): | |
| if not name: | |
| return gr.update(), gr.update() | |
| binder, protein = load_example(name) | |
| show_protein = name in ["Protein-Peptide", "Protein-Cyclic Peptide (SMILES)"] | |
| return ( | |
| gr.update(value=binder), | |
| gr.update(value=protein, visible=show_protein), | |
| ) | |
| def on_modality_change(modality, *checkbox_values): | |
| ctx = initialize() | |
| available = get_available_properties(ctx, modality) | |
| updates = [] | |
| for i, prop_key in enumerate(PROP_ORDER): | |
| is_available = available.get(prop_key, False) | |
| prop_info = PROPERTY_INFO[prop_key] | |
| label_text = f"{prop_info['display']} {prop_info.get('direction','')}".rstrip() | |
| if not is_available: | |
| label_text += " (Not supported)" | |
| if prop_key == "binding_affinity" and is_available: | |
| label_text += " *" | |
| current_value = checkbox_values[i] if i < len(checkbox_values) else False | |
| updates.append(gr.update( | |
| label=label_text, | |
| interactive=is_available, | |
| value=False if not is_available else current_value | |
| )) | |
| return updates | |
| def collect_selected_properties(*checkbox_values): | |
| selected = [] | |
| for i, prop_key in enumerate(PROP_ORDER): | |
| if i < len(checkbox_values) and checkbox_values[i]: | |
| selected.append(prop_key) | |
| return selected | |
| # ==================== Gradio App ==================== | |
| def load_custom_css(): | |
| """Load CSS styling document""" | |
| css_file = "peptiverse_styles.css" | |
| try: | |
| with open(css_file, 'r', encoding='utf-8') as f: | |
| return f.read() | |
| except FileNotFoundError: | |
| print(f"Warning: CSS file '{css_file}' not found. Using default styles.") | |
| # Minimal fallback CSS | |
| return """ | |
| .gradio-container { | |
| font-family: 'Inter', -apple-system, BlinkMacSystemFont, 'Segoe UI', Roboto, sans-serif; | |
| font-size: 16px !important; | |
| } | |
| """ | |
| except Exception as e: | |
| print(f"Error loading CSS: {e}") | |
| return "" | |
| custom_css = load_custom_css() | |
| def get_title_html(): | |
| """Load light/dark SVG title and swap via prefers-color-scheme""" | |
| import base64, os | |
| def load_svg_b64(path): | |
| if not os.path.exists(path): | |
| return None | |
| with open(path, "rb") as f: | |
| return base64.b64encode(f.read()).decode("utf-8") | |
| light_b64 = load_svg_b64("peptiverse-light-withlogo.svg") | |
| dark_b64 = load_svg_b64("peptiverse-dark-withlogo.svg") | |
| if light_b64 or dark_b64: | |
| imgs = [] | |
| if light_b64: | |
| imgs.append(f''' | |
| <img class="logo logo-light" | |
| src="data:image/svg+xml;base64,{light_b64}" | |
| alt="PeptiVerse" | |
| style="max-height: 200px;" /> | |
| ''') | |
| if dark_b64: | |
| imgs.append(f''' | |
| <img class="logo logo-dark" | |
| src="data:image/svg+xml;base64,{dark_b64}" | |
| alt="PeptiVerse" | |
| style="max-height: 200px;" /> | |
| ''') | |
| return f''' | |
| <div class="svg-title-container"> | |
| {''.join(imgs)} | |
| </div> | |
| ''' | |
| # ---------- Fallback ---------- | |
| return ''' | |
| <div class="svg-title-container"> | |
| <svg xmlns="http://www.w3.org/2000/svg" viewBox="0 0 700 140" | |
| style="width: 100%; max-width: 700px; height: auto;"> | |
| <defs> | |
| <linearGradient id="titleGradient" x1="0%" y1="0%" x2="100%" y2="100%"> | |
| <stop offset="0%" style="stop-color:#667eea"/> | |
| <stop offset="100%" style="stop-color:#764ba2"/> | |
| </linearGradient> | |
| <filter id="shadow"> | |
| <feDropShadow dx="0" dy="3" stdDeviation="4" flood-opacity="0.15"/> | |
| </filter> | |
| </defs> | |
| <text x="50%" y="50%" | |
| text-anchor="middle" | |
| dominant-baseline="middle" | |
| style="font-size:72px;font-weight:bold; | |
| fill:url(#titleGradient);filter:url(#shadow);"> | |
| π PeptiVerse | |
| </text> | |
| </svg> | |
| </div> | |
| ''' | |
| with gr.Blocks(css=custom_css, theme=gr.themes.Soft(primary_hue="indigo")) as demo: | |
| ctx = initialize() | |
| # Header with SVG title support | |
| title_html = get_title_html() | |
| gr.HTML(title_html) | |
| gr.Markdown( | |
| """ | |
| # π PeptiVerse | |
| """, | |
| visible=False | |
| ) | |
| with gr.Tabs(): | |
| # Main Prediction Tab | |
| with gr.TabItem("π¬ Predict", elem_classes="predict-tab"): | |
| with gr.Row(): | |
| # Input Section | |
| with gr.Column(scale=1): | |
| with gr.Group(): | |
| gr.Markdown("### π Input") | |
| input_type = gr.Radio( | |
| ["Sequence", "SMILES"], | |
| label="Input Type", | |
| value="Sequence" | |
| ) | |
| # Load T7 peptide by default | |
| input_text = gr.Textbox( | |
| label="Peptide Sequence(s) / SMILES", | |
| placeholder="Enter amino acid sequence(s) or SMILES, one per line", | |
| lines=6, | |
| value="HAIYPRH" | |
| ) | |
| protein_seq = gr.Textbox( | |
| label="Protein Sequence (for binding prediction)", | |
| placeholder="Enter target protein sequence", | |
| lines=3, | |
| visible=False | |
| ) | |
| gr.Markdown("**Examples:**") | |
| example_dropdown = gr.Dropdown( | |
| choices=["None", "T7 Peptide", "Protein-Peptide", "Cyclic Peptide (SMILES)", "Protein-Cyclic Peptide (SMILES)"], | |
| label="Load Example", | |
| value="T7 Peptide", # Set T7 as default | |
| interactive=True, | |
| allow_custom_value=False | |
| ) | |
| # Property Selection | |
| with gr.Column(scale=1): | |
| with gr.Group(): | |
| gr.Markdown("### βοΈ Select Properties") | |
| with gr.Accordion("Physicochemical Properties", open=True, elem_id="acc_phys"): | |
| include_physicochemical = gr.Checkbox( | |
| label="π§ͺ Calculate Basic Properties", | |
| value=True, | |
| info="MW, net charge, pI, hydrophobicity (Sequence only)" | |
| ) | |
| pH_value = gr.Slider( | |
| minimum=0, | |
| maximum=14, | |
| value=7.0, | |
| step=0.1, | |
| label="pH for Net Charge", | |
| info="Physiological pH is ~7.4" | |
| ) | |
| # Create individual checkboxes in fixed order | |
| with gr.Accordion("Prediction Properties", open=True, elem_id="acc_pred"): | |
| property_checkboxes = [] | |
| available = get_available_properties(ctx, "Sequence") | |
| for prop_key in PROP_ORDER: | |
| prop_info = PROPERTY_INFO[prop_key] | |
| is_available = available.get(prop_key, False) | |
| label_text = f"{prop_info['display']} {prop_info.get('direction','')}".rstrip() | |
| if not is_available: | |
| label_text += " (Not supported)" | |
| if prop_key == "binding_affinity" and is_available: | |
| label_text += " *" | |
| default_on = (prop_key in ["solubility", "hemolysis"]) # optional defaults | |
| cb = gr.Checkbox( | |
| label=label_text, | |
| value=is_available and default_on, | |
| interactive=is_available, | |
| elem_id=f"checkbox_{prop_key}", | |
| ) | |
| property_checkboxes.append(cb) | |
| gr.Markdown("*Requires protein sequence input above", elem_classes="text-sm text-gray-500") | |
| # Best Models Tab | |
| with gr.TabItem("π Best Models", elem_classes="best-models-tab"): | |
| gr.Markdown("### Current Best Models Configuration") | |
| gr.Markdown("This table shows the models and thresholds currently being used for predictions:") | |
| best_models_df = gr.Dataframe( | |
| value=get_best_models_table(ctx), | |
| headers=["Property", "Best Model (Sequence)", "Threshold (Sequence)", | |
| "Best Model (SMILES)", "Threshold (SMILES)", "Task Type"], | |
| interactive=False, | |
| elem_id="best_models_df" | |
| ) | |
| gr.Markdown(""" | |
| **Note:** Models marked as SVM, SVR, or ENET are automatically replaced with XGB | |
| as these models are not currently supported in the deployment environment. | |
| """) | |
| # Distribution Analysis Tab | |
| with gr.TabItem("π Distributions", elem_classes="distributions-tab"): | |
| with gr.Row(): | |
| with gr.Column(scale=1): | |
| base_props = [ | |
| k for k in PROPERTY_INFO.keys() | |
| if k not in {"halflife", "binding_affinity"} | |
| ] | |
| dist_choices = base_props + list(DIST_KEYS.keys()) | |
| property_selector = gr.Dropdown( | |
| choices=dist_choices, | |
| label="Select Property", | |
| value="binding_affinity_all" | |
| ) | |
| test_value = gr.Number(label="Test Value among Distribution", value=None) | |
| show_dist_btn = gr.Button("Show Distribution") | |
| with gr.Column(scale=2): | |
| dist_plot_tab = gr.Plot(label="Score Distribution") | |
| dist_info_tab = gr.Markdown() | |
| # Data Documentation Tab | |
| with gr.TabItem("π Documentation", elem_classes="documentation-tab"): | |
| # Load documentation | |
| doc_file_path = "description.md" | |
| try: | |
| with open(doc_file_path, "r", encoding="utf-8") as f: | |
| markdown_content = f.read() | |
| except FileNotFoundError: | |
| print(f"Warning: Documentation file '{doc_file_path}' not found.") | |
| markdown_content = """ | |
| # Documentation | |
| Documentation file not found. Please ensure `description.md` is in the same directory as the app. | |
| """ | |
| except Exception as e: | |
| print(f"Error loading documentation: {e}") | |
| markdown_content = "# Error loading documentation" | |
| gr.Markdown(markdown_content) | |
| # Action Buttons | |
| with gr.Row(): | |
| clear_btn = gr.Button("ποΈ Clear", variant="secondary") | |
| predict_btn = gr.Button("π Predict Properties", variant="primary", scale=2) | |
| # Status | |
| status_output = gr.Markdown("") | |
| # Results Section | |
| with gr.Group(): | |
| gr.Markdown("### π Results") | |
| results_df = gr.Dataframe( | |
| headers=["Input", "Property", "Prediction", "Value", "Unit"], | |
| datatype=["str", "str", "str", "str", "str"], | |
| interactive=False, | |
| elem_id="results_df" | |
| ) | |
| # Footer | |
| gr.Markdown( | |
| """ | |
| --- | |
| <div style='text-align: center; color: #6b7280;'> | |
| <p>PeptiVerse - A Unified Platform for peptide therapeutic property prediction.</p> | |
| <p>Please cite our work if you use this tool in your research.</p> | |
| </div> | |
| """ | |
| ) | |
| # Event Handlers | |
| def update_visibility(binding_checked): | |
| return gr.update(visible=binding_checked) | |
| # Update checkbox states when modality changes | |
| input_type.change( | |
| on_modality_change, | |
| inputs=[input_type] + property_checkboxes, | |
| outputs=property_checkboxes | |
| ) | |
| # Show protein sequence input when binding affinity is selected | |
| BINDING_IDX = PROP_ORDER.index("binding_affinity") | |
| property_checkboxes[BINDING_IDX].change( | |
| update_visibility, | |
| inputs=[property_checkboxes[BINDING_IDX]], | |
| outputs=[protein_seq], | |
| ) | |
| example_dropdown.change( | |
| on_example_change, | |
| inputs=[example_dropdown], | |
| outputs=[input_text, protein_seq] | |
| ) | |
| predict_btn.click( | |
| lambda input_text, input_type, protein_text, include_physicochemical, pH_value, *checkbox_values: | |
| predict_properties( | |
| input_text, input_type, protein_text, | |
| collect_selected_properties(*checkbox_values), | |
| include_physicochemical, pH_value | |
| ), | |
| inputs=[input_text, input_type, protein_seq, include_physicochemical, pH_value] + property_checkboxes, | |
| outputs=[results_df, status_output] | |
| ) | |
| clear_btn.click( | |
| lambda: ["", "", "None", None, ""] + [False] * len(property_checkboxes), | |
| outputs=[input_text, protein_seq, example_dropdown, results_df, status_output] + property_checkboxes | |
| ) | |
| show_dist_btn.click( | |
| show_distribution, | |
| inputs=[property_selector, test_value], | |
| outputs=[dist_plot_tab, dist_info_tab] | |
| ) | |
| if __name__ == "__main__": | |
| print("Initializing models...") | |
| initialize() | |
| print("Ready!") | |
| demo.launch(share=True) |